BLASTX nr result
ID: Ephedra29_contig00015992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00015992 (535 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006856031.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 61 8e-08 XP_002981034.1 hypothetical protein SELMODRAFT_154282 [Selaginel... 60 1e-07 XP_008783465.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 59 5e-07 KDO79518.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] 59 7e-07 XP_008812364.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 8e-07 KQK89613.1 hypothetical protein SETIT_035381mg [Setaria italica] 58 1e-06 KJB71041.1 hypothetical protein B456_011G101900 [Gossypium raimo... 58 1e-06 EMS64156.1 U1 small nuclear ribonucleoprotein 70 kDa [Triticum u... 58 1e-06 XP_016698653.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_016678509.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_012454635.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 BAJ90924.1 predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 XP_016681791.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_010933717.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_017649180.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_020158324.1 U1 small nuclear ribonucleoprotein 70 kDa-like [A... 58 1e-06 XP_010933716.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_009381289.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_010919474.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 58 1e-06 XP_010263700.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 57 2e-06 >XP_006856031.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Amborella trichopoda] ERN17498.1 hypothetical protein AMTR_s00059p00067090 [Amborella trichopoda] Length = 458 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+HDK TN PRGYAF+EY+HTRDMKTAYK Sbjct: 166 RVRLIHDKTTNKPRGYAFIEYVHTRDMKTAYK 197 >XP_002981034.1 hypothetical protein SELMODRAFT_154282 [Selaginella moellendorffii] EFJ17735.1 hypothetical protein SELMODRAFT_154282 [Selaginella moellendorffii] Length = 246 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +3 Query: 363 GLSCQLYCHEGPAIQVTTKALL---YT*KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 G++C L A+Q LL + +V LVHDK++N PRGYAF+EY HTRDMK AYK Sbjct: 8 GIACILIVRLVCALQSARIVLLNALFVLQVRLVHDKDSNKPRGYAFIEYFHTRDMKAAYK 67 >XP_008783465.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] XP_008783466.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] Length = 512 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 165 RVRLITDKETNKPRGYAFIEYMHTRDMKTAYK 196 >KDO79518.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] Length = 501 Score = 58.5 bits (140), Expect = 7e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 KV LV DK TN PRGYAF+EYMHTRDMK AYK Sbjct: 187 KVRLVTDKETNKPRGYAFIEYMHTRDMKAAYK 218 >XP_008812364.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] Length = 277 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 195 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYK 226 >KQK89613.1 hypothetical protein SETIT_035381mg [Setaria italica] Length = 360 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 426 LYT*KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 LY KV LV +K+T+ PRGYAF+EYMHTRDMK AYK Sbjct: 31 LYICKVRLVTEKDTSKPRGYAFIEYMHTRDMKNAYK 66 >KJB71041.1 hypothetical protein B456_011G101900 [Gossypium raimondii] Length = 404 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >EMS64156.1 U1 small nuclear ribonucleoprotein 70 kDa [Triticum urartu] Length = 454 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 145 RVRLVTDKDTNKPRGYAFIEYMHTRDMKNAYK 176 >XP_016698653.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Gossypium hirsutum] Length = 467 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >XP_016678509.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Gossypium hirsutum] Length = 467 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >XP_012454635.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Gossypium raimondii] KJB71042.1 hypothetical protein B456_011G101900 [Gossypium raimondii] Length = 471 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >BAJ90924.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 473 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 167 RVRLVTDKDTNKPRGYAFIEYMHTRDMKNAYK 198 >XP_016681791.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Gossypium hirsutum] Length = 475 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >XP_010933717.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like isoform X2 [Elaeis guineensis] Length = 475 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 165 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYK 196 >XP_017649180.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Gossypium arboreum] KHG19260.1 U1 small nuclear ribonucleoprotein 70 kDa -like protein [Gossypium arboreum] Length = 475 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 169 RVRLVTDKSTNKPRGYAFIEYMHTRDMKAAYK 200 >XP_020158324.1 U1 small nuclear ribonucleoprotein 70 kDa-like [Aegilops tauschii subsp. tauschii] Length = 479 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V LV DK+TN PRGYAF+EYMHTRDMK AYK Sbjct: 167 RVRLVTDKDTNKPRGYAFIEYMHTRDMKNAYK 198 >XP_010933716.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like isoform X1 [Elaeis guineensis] Length = 500 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 165 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYK 196 >XP_009381289.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Musa acuminata subsp. malaccensis] Length = 510 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 165 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYK 196 >XP_010919474.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Elaeis guineensis] Length = 520 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V L+ DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 165 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYK 196 >XP_010263700.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Nelumbo nucifera] Length = 448 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 438 KVTLVHDKNTNMPRGYAFVEYMHTRDMKTAYK 533 +V +V DK TN PRGYAF+EYMHTRDMKTAYK Sbjct: 167 RVRMVTDKVTNKPRGYAFIEYMHTRDMKTAYK 198