BLASTX nr result
ID: Ephedra29_contig00015706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00015706 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE23310.1 hypothetical protein AXG93_1713s1100 [Marchantia poly... 52 6e-06 >OAE23310.1 hypothetical protein AXG93_1713s1100 [Marchantia polymorpha subsp. polymorpha] Length = 1536 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = -2 Query: 162 RLRRKMLECVLKFVQGWAPHTRNSVTPPLIQAIQANDKQLISDLLDSGAPVD 7 ++ RK+LECVL F + H ++ PPL++A QAND+ L+S LL++GAP++ Sbjct: 552 KIARKLLECVLLFGPRLSAHPQSPSLPPLLRAAQANDEVLLSLLLEAGAPIN 603