BLASTX nr result
ID: Ephedra29_contig00015106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00015106 (519 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001780388.1 predicted protein [Physcomitrella patens] AAL8417... 67 6e-10 AAT85662.1 polyunsaturated fatty acid elongase [Marchantia polym... 55 5e-06 >XP_001780388.1 predicted protein [Physcomitrella patens] AAL84174.1 polyunsaturated fatty acid specific elongation enzyme 1 [Physcomitrella patens] BAE71131.1 polyunsaturated fatty acid specific elongation enzyme 1 [Physcomitrella patens] EDQ54842.1 predicted protein [Physcomitrella patens] Length = 290 Score = 66.6 bits (161), Expect = 6e-10 Identities = 40/107 (37%), Positives = 60/107 (56%) Frame = +1 Query: 4 MVKEWYMGVDEKVGRWAKKAIEAKAGVELTSVPATRGLPTIDTPPVGMLVLASYLIIIGL 183 +V+ +Y +D KV + A+ GVELT P T+GLP +D+P +L ++ YL I+ Sbjct: 3 VVERFYGELDGKVSQGVN-ALLGSFGVELTDTPTTKGLPLVDSPTPIVLGVSVYLTIVIG 61 Query: 184 GTLHIRISGLKPRGANEPLFIRSIVXXXXXXXXXXXXYMCFGILFQA 324 G L I+ LKPR A+EP ++++V YMC GI +QA Sbjct: 62 GLLWIKARDLKPR-ASEPFLLQALVLVHNLFCFALSLYMCVGIAYQA 107 >AAT85662.1 polyunsaturated fatty acid elongase [Marchantia polymorpha] Length = 290 Score = 55.5 bits (132), Expect = 5e-06 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 1/105 (0%) Frame = +1 Query: 13 EWYMGVDEKVGRWAKKAIEA-KAGVELTSVPATRGLPTIDTPPVGMLVLASYLIIIGLGT 189 E Y VD V + + ++ + GV LT T+GLP +D+P +L L+SYL + LG Sbjct: 2 EAYEMVDSFVSKTVFETLQRLRGGVVLTESAITKGLPCVDSPTPIVLGLSSYLTFVFLGL 61 Query: 190 LHIRISGLKPRGANEPLFIRSIVXXXXXXXXXXXXYMCFGILFQA 324 + I+ LKPR + EP + V YMC GI+ QA Sbjct: 62 IVIKSLDLKPR-SKEPAILNLFVIFHNFVCFALSLYMCVGIVRQA 105