BLASTX nr result
ID: Ephedra29_contig00015105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00015105 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001780388.1 predicted protein [Physcomitrella patens] AAL8417... 52 4e-06 >XP_001780388.1 predicted protein [Physcomitrella patens] AAL84174.1 polyunsaturated fatty acid specific elongation enzyme 1 [Physcomitrella patens] BAE71131.1 polyunsaturated fatty acid specific elongation enzyme 1 [Physcomitrella patens] EDQ54842.1 predicted protein [Physcomitrella patens] Length = 290 Score = 52.4 bits (124), Expect = 4e-06 Identities = 32/81 (39%), Positives = 48/81 (59%) Frame = +3 Query: 3 MVKEWYAGVDEKVGRWAKKAIEAKAGVELTSAPTTRGQPTIDTPPVGMLVLASYLVIVGL 182 +V+ +Y +D KV + A+ GVELT PTT+G P +D+P +L ++ YL IV Sbjct: 3 VVERFYGELDGKVSQGVN-ALLGSFGVELTDTPTTKGLPLVDSPTPIVLGVSVYLTIVIG 61 Query: 183 SMLRIRISGLKPRGANEPLFI 245 +L I+ LKPR A+EP + Sbjct: 62 GLLWIKARDLKPR-ASEPFLL 81