BLASTX nr result
ID: Ephedra29_contig00014192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00014192 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACN40583.1 unknown [Picea sitchensis] 55 1e-07 ABK21878.1 unknown [Picea sitchensis] 55 1e-07 WP_071414510.1 hypothetical protein [Acinetobacter baumannii] OI... 50 9e-06 >ACN40583.1 unknown [Picea sitchensis] Length = 151 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +2 Query: 95 MAQSASVDVELKVPAEKVMEVLKGSVQLFPKIMPDMYKSIQV 220 MAQS SV+++LKVPA+K + ++ S LFPKIMP +KSI+V Sbjct: 1 MAQSVSVEIDLKVPAQKAWDAIRDSASLFPKIMPSHFKSIEV 42 >ABK21878.1 unknown [Picea sitchensis] Length = 151 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +2 Query: 95 MAQSASVDVELKVPAEKVMEVLKGSVQLFPKIMPDMYKSIQV 220 MAQS SV+++LKVPA+K + ++ S LFPKIMP +KSI+V Sbjct: 1 MAQSVSVEIDLKVPAQKAWDAIRDSASLFPKIMPSHFKSIEV 42 >WP_071414510.1 hypothetical protein [Acinetobacter baumannii] OIC57260.1 hypothetical protein A7L55_19100 [Acinetobacter baumannii] Length = 157 Score = 50.1 bits (118), Expect = 9e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 83 EYKEMAQSASVDVELKVPAEKVMEVLKGSVQLFPKIMPDMYKSIQV 220 + K+MAQ+ SV+++LKV A+K+ ++ S LFPKIMP +KSI+V Sbjct: 3 QLKKMAQTVSVEIDLKVFAQKLWGAIQDSATLFPKIMPSHFKSIEV 48