BLASTX nr result
ID: Ephedra29_contig00014112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00014112 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEC11044.1 alcohol dehydrogenase, partial [Camellia sinensis] 49 7e-06 >AEC11044.1 alcohol dehydrogenase, partial [Camellia sinensis] Length = 43 Score = 48.9 bits (115), Expect = 7e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 309 IAEGIEKAPAALVGLFLGRNVGKQIVKVSSE 217 IAEG+E APAAL+GLF+G NVGKQ+V V+ E Sbjct: 13 IAEGLESAPAALIGLFVGHNVGKQVVVVARE 43