BLASTX nr result
ID: Ephedra29_contig00013922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013922 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE29629.1 hypothetical protein AXG93_1762s1090 [Marchantia poly... 60 2e-08 >OAE29629.1 hypothetical protein AXG93_1762s1090 [Marchantia polymorpha subsp. polymorpha] Length = 1511 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 8/69 (11%) Frame = -3 Query: 270 LRLLFQDKRRHTLYYDDDHSIYAWTLSNGFSK--GGIH------YVAAWFYAHLEGKMPI 115 +R LF D+RR ++ +DD+H IY W+L+ ++ G IH VA WFY HLEG + I Sbjct: 24 MRSLFTDRRRQSILFDDEHFIYTWSLNRDRNQAAGAIHSGKRVEAVAGWFYEHLEGSVQI 83 Query: 114 IIITDSGPS 88 + I SG S Sbjct: 84 VAIQTSGES 92