BLASTX nr result
ID: Ephedra29_contig00013784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013784 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR16651.1 unknown [Picea sitchensis] 79 2e-14 XP_010087246.1 putative dimethyladenosine transferase [Morus not... 68 1e-10 XP_002320304.1 hypothetical protein POPTR_0014s11630g [Populus t... 66 8e-10 XP_019158073.1 PREDICTED: ribosomal RNA small subunit methyltran... 66 8e-10 XP_009804609.1 PREDICTED: probable dimethyladenosine transferase... 65 1e-09 XP_009617800.1 PREDICTED: ribosomal RNA small subunit methyltran... 65 1e-09 XP_019242812.1 PREDICTED: ribosomal RNA small subunit methyltran... 65 1e-09 XP_019182262.1 PREDICTED: ribosomal RNA small subunit methyltran... 65 2e-09 XP_010523927.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 3e-09 XP_003573385.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 4e-09 XP_013747534.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 5e-09 XP_017969554.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 5e-09 XP_016745387.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 5e-09 XP_016693211.1 PREDICTED: ribosomal RNA small subunit methyltran... 64 5e-09 XP_020150879.1 ribosomal RNA small subunit methyltransferase-lik... 64 5e-09 XP_011084280.1 PREDICTED: probable dimethyladenosine transferase... 64 5e-09 EMS47567.1 putative dimethyladenosine transferase [Triticum urartu] 64 5e-09 XP_016538776.1 PREDICTED: ribosomal RNA small subunit methyltran... 63 7e-09 OEL37480.1 Ribosomal RNA small subunit methyltransferase [Dichan... 63 7e-09 KNA26027.1 hypothetical protein SOVF_000960 [Spinacia oleracea] 63 7e-09 >ABR16651.1 unknown [Picea sitchensis] Length = 346 Score = 78.6 bits (192), Expect = 2e-14 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -2 Query: 450 QDMDVDDSEMQ-GEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHF 283 QDMDVDD++MQ G QFK KVL ILK DKRSSKL+QDDFL LLS FN+AGIHF Sbjct: 289 QDMDVDDADMQEGASQFKDKVLNILKEGGFEDKRSSKLAQDDFLYLLSLFNKAGIHF 345 >XP_010087246.1 putative dimethyladenosine transferase [Morus notabilis] EXB28596.1 putative dimethyladenosine transferase [Morus notabilis] Length = 355 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/58 (55%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -2 Query: 450 QDMDVDDSEMQGEP-QFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 ++M+V+D +++GEP +FK KVLA+LK +KRSSKL+ +FL LLS FN+AGIHF+ Sbjct: 298 EEMEVEDGDVEGEPSEFKDKVLAVLKEGDFEEKRSSKLTLQEFLYLLSLFNKAGIHFS 355 >XP_002320304.1 hypothetical protein POPTR_0014s11630g [Populus trichocarpa] EEE98619.1 hypothetical protein POPTR_0014s11630g [Populus trichocarpa] Length = 353 Score = 65.9 bits (159), Expect = 8e-10 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEMQGEP-QFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M+V+D + GE +FK KVLA+LK +KRSSKLSQ++FL LLS FN AGIHF+ Sbjct: 297 EMEVEDGDADGEASEFKQKVLAVLKERDYSEKRSSKLSQEEFLHLLSQFNMAGIHFS 353 >XP_019158073.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Ipomoea nil] XP_019158074.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Ipomoea nil] XP_019158075.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Ipomoea nil] XP_019158076.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Ipomoea nil] Length = 355 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +MD+DD + +G FK KVL++LK DKRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 301 EMDMDDGDAKGS-DFKEKVLSVLKQGKFEDKRSSKLTQVDFMHLLSLFNKAGIHFS 355 >XP_009804609.1 PREDICTED: probable dimethyladenosine transferase [Nicotiana sylvestris] XP_016503627.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Nicotiana tabacum] Length = 354 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M+VDD + + +FK KVLA+LK DKRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 300 EMEVDDGDAK-RSEFKEKVLAVLKEGKYEDKRSSKLTQADFMHLLSLFNKAGIHFS 354 >XP_009617800.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Nicotiana tomentosiformis] XP_016443045.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Nicotiana tabacum] Length = 356 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M+VDD + + +FK KVLA+LK DKRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 302 EMEVDDGDAK-RSEFKEKVLAVLKEGKFEDKRSSKLTQADFMHLLSLFNKAGIHFS 356 >XP_019242812.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Nicotiana attenuata] OIT07614.1 ribosomal rna small subunit methyltransferase [Nicotiana attenuata] Length = 357 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M+VDD + + +FK KVLA+LK DKRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 303 EMEVDDGDAK-RSEFKEKVLAVLKEGKYEDKRSSKLAQADFMHLLSLFNKAGIHFS 357 >XP_019182262.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Ipomoea nil] Length = 355 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +MD+DD + +G FK KV+++LK DKRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 301 EMDMDDGDAKGS-DFKEKVVSVLKQGKFEDKRSSKLTQVDFMHLLSLFNKAGIHFS 355 >XP_010523927.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Tarenaya hassleriana] Length = 351 Score = 64.3 bits (155), Expect = 3e-09 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEMQGE-PQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M++DD E GE +FK KV +LK DKRSSKLSQ +FL LLS FN+AGIHF+ Sbjct: 295 EMEMDDGEGDGEVSEFKEKVSNVLKEGDFEDKRSSKLSQQEFLYLLSLFNKAGIHFS 351 >XP_003573385.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Brachypodium distachyon] KQJ95064.1 hypothetical protein BRADI_3g15000 [Brachypodium distachyon] Length = 354 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/58 (51%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -2 Query: 447 DMDVDDSEMQGEPQ--FKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M++DD++M G+ + FK K++ IL+ +KRSSKLSQ DFL LLS FN+AG+HF+ Sbjct: 297 EMEMDDADMVGDDRASFKEKIMGILQQGDFAEKRSSKLSQVDFLYLLSLFNKAGVHFS 354 >XP_013747534.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Brassica napus] Length = 346 Score = 63.5 bits (153), Expect = 5e-09 Identities = 29/57 (50%), Positives = 42/57 (73%) Frame = -2 Query: 450 QDMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +DM++D+ + G +FK KV+ +LK +KRSSKLSQ +FL LLS FN++GIHF+ Sbjct: 290 EDMEMDEGQGGGGGEFKEKVMNVLKEGGFEEKRSSKLSQQEFLYLLSLFNKSGIHFS 346 >XP_017969554.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Theobroma cacao] EOX95250.1 Ribosomal RNA adenine dimethylase family protein [Theobroma cacao] Length = 347 Score = 63.5 bits (153), Expect = 5e-09 Identities = 31/57 (54%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEMQGE-PQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +MDV+ E +GE +FK+KVL++LK + ++R+SKLSQ+ FL LLS FN+AGIHF+ Sbjct: 291 EMDVECDEAEGEVSEFKNKVLSVLKEGNFEEQRASKLSQESFLTLLSMFNKAGIHFS 347 >XP_016745387.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Gossypium hirsutum] Length = 349 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/57 (52%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEMQGE-PQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 DM+ D++E +GE +FK+KV+++LK ++R+SKLSQ+ FL LLS FN+AGIHF+ Sbjct: 293 DMECDEAEGEGEVSEFKNKVISVLKEGKFEEQRASKLSQESFLTLLSMFNKAGIHFS 349 >XP_016693211.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Gossypium hirsutum] XP_017623949.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Gossypium arboreum] KHG08361.1 putative dimethyladenosine transferase [Gossypium arboreum] Length = 349 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/57 (52%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEMQGE-PQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 DM+ D++E +GE +FK+KV+++LK ++R+SKLSQ+ FL LLS FN+AGIHF+ Sbjct: 293 DMECDEAEGEGEVSEFKNKVISVLKEGKFEEQRASKLSQESFLTLLSMFNKAGIHFS 349 >XP_020150879.1 ribosomal RNA small subunit methyltransferase-like [Aegilops tauschii subsp. tauschii] XP_020150880.1 ribosomal RNA small subunit methyltransferase-like [Aegilops tauschii subsp. tauschii] Length = 352 Score = 63.5 bits (153), Expect = 5e-09 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEM-QGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 DM++DD++ G FK K++ IL+ +KRSSKLSQ DFL LLS FN+AGIHF+ Sbjct: 296 DMEMDDADAADGRTSFKEKIMGILQQGDFAEKRSSKLSQVDFLYLLSLFNKAGIHFS 352 >XP_011084280.1 PREDICTED: probable dimethyladenosine transferase [Sesamum indicum] Length = 355 Score = 63.5 bits (153), Expect = 5e-09 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = -2 Query: 450 QDMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +DM++DD E + FK KVL +LK DKR+SKLSQ DF+ LLS FN+AGIHF+ Sbjct: 300 EDMEMDDGETKAS-DFKDKVLDVLKLGGFEDKRASKLSQADFMHLLSLFNKAGIHFS 355 >EMS47567.1 putative dimethyladenosine transferase [Triticum urartu] Length = 356 Score = 63.5 bits (153), Expect = 5e-09 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 447 DMDVDDSEM-QGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 DM++DD++ G FK K++ IL+ +KRSSKLSQ DFL LLS FN+AGIHF+ Sbjct: 300 DMEMDDADAADGRASFKEKIMGILQQGDFAEKRSSKLSQVDFLYLLSLFNKAGIHFS 356 >XP_016538776.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Capsicum annuum] Length = 355 Score = 63.2 bits (152), Expect = 7e-09 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -2 Query: 447 DMDVDDSEMQGEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 DM++DD + + FK KVLA+LK +KRSSKL+Q DF+ LLS FN+AGIHF+ Sbjct: 301 DMEMDDGDAK-RADFKEKVLAVLKEGKFEEKRSSKLAQADFMHLLSLFNKAGIHFS 355 >OEL37480.1 Ribosomal RNA small subunit methyltransferase [Dichanthelium oligosanthes] Length = 359 Score = 63.2 bits (152), Expect = 7e-09 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = -2 Query: 447 DMDVDDSEMQGE--PQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHFA 280 +M++DD++M G+ FK KV+ IL+ +KR SKLSQ DFL LLS FN+AGIHF+ Sbjct: 302 EMEMDDADMAGDGAASFKEKVMGILQQGDFAEKRGSKLSQVDFLYLLSLFNKAGIHFS 359 >KNA26027.1 hypothetical protein SOVF_000960 [Spinacia oleracea] Length = 364 Score = 63.2 bits (152), Expect = 7e-09 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (1%) Frame = -2 Query: 447 DMDVDDSEMQ-GEPQFKSKVLAILKNASCGDKRSSKLSQDDFLQLLSFFNEAGIHF 283 D D D++EMQ + FK KV+ +LK DKRSSKL+Q++F+ LLS FN+AGIHF Sbjct: 305 DADSDNNEMQINDSGFKGKVIGVLKQYDYADKRSSKLTQNEFIHLLSVFNQAGIHF 360