BLASTX nr result
ID: Ephedra29_contig00013685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013685 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF35017.1 pentatricopeptide repeat-containing protein, putative... 54 2e-06 XP_015579767.1 PREDICTED: putative pentatricopeptide repeat-cont... 54 2e-06 XP_010261530.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 >EEF35017.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 687 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/92 (31%), Positives = 53/92 (57%), Gaps = 6/92 (6%) Frame = -1 Query: 260 NFNMSATKEHLKRL--FQSLCHIK----LNPKTCITIIQECTNLRAVTELNLIYAQIIRL 99 N + + E +K L ++LC IK + P + ++QECT +V+E +I+A II+ Sbjct: 44 NTQLDGSLEPIKPLEFHEALCFIKEEKKIEPSYYLPLLQECTKKNSVSEAQVIHAHIIKT 103 Query: 98 GIENNSNILKNLVLGFSKCENLENARQLFDKM 3 G + ++ +LV ++KC + NAR++FD + Sbjct: 104 GTHKDLAVMTSLVNVYAKCGAMGNARKIFDSL 135 >XP_015579767.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Ricinus communis] Length = 770 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/92 (31%), Positives = 53/92 (57%), Gaps = 6/92 (6%) Frame = -1 Query: 260 NFNMSATKEHLKRL--FQSLCHIK----LNPKTCITIIQECTNLRAVTELNLIYAQIIRL 99 N + + E +K L ++LC IK + P + ++QECT +V+E +I+A II+ Sbjct: 44 NTQLDGSLEPIKPLEFHEALCFIKEEKKIEPSYYLPLLQECTKKNSVSEAQVIHAHIIKT 103 Query: 98 GIENNSNILKNLVLGFSKCENLENARQLFDKM 3 G + ++ +LV ++KC + NAR++FD + Sbjct: 104 GTHKDLAVMTSLVNVYAKCGAMGNARKIFDSL 135 >XP_010261530.1 PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial [Nelumbo nucifera] Length = 975 Score = 53.5 bits (127), Expect = 4e-06 Identities = 29/76 (38%), Positives = 45/76 (59%) Frame = -1 Query: 230 LKRLFQSLCHIKLNPKTCITIIQECTNLRAVTELNLIYAQIIRLGIENNSNILKNLVLGF 51 L R Q C +K N T + ++Q C NL A+ E I+ +IR G+E+N ++ +L+ + Sbjct: 283 LFREMQFSC-VKANSFTIVKVLQACGNLEALKEGQQIHGHVIRSGLESNLSLCNSLISMY 341 Query: 50 SKCENLENARQLFDKM 3 SK LE AR++FD M Sbjct: 342 SKNSELERARKVFDFM 357