BLASTX nr result
ID: Ephedra29_contig00013524
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013524 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012844331.1 PREDICTED: uncharacterized protein At3g27210-like... 57 6e-07 >XP_012844331.1 PREDICTED: uncharacterized protein At3g27210-like isoform X2 [Erythranthe guttata] EYU45395.1 hypothetical protein MIMGU_mgv1a013394mg [Erythranthe guttata] Length = 221 Score = 56.6 bits (135), Expect = 6e-07 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 7/61 (11%) Frame = +3 Query: 249 ETVNVHDGEVSI-------PARGTPAASKDDAFFDSFPFLESDAEDDFITVNGDTLQSTW 407 +TV+V D V + PAR A SKD+AFFDS P+LESD EDDF++VNGD S Sbjct: 39 DTVDVVDRTVPVAVNSHFSPARFPHAGSKDEAFFDSQPWLESDCEDDFVSVNGDFTPSRG 98 Query: 408 S 410 S Sbjct: 99 S 99