BLASTX nr result
ID: Ephedra29_contig00013479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013479 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010531541.1 PREDICTED: thaumatin-like protein 1b [Tarenaya ha... 70 1e-11 XP_013456481.1 pathogenesis-related thaumatin family protein [Me... 69 3e-11 XP_012081742.1 PREDICTED: thaumatin-like protein 1b isoform X3 [... 69 4e-11 XP_012081741.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 69 4e-11 XP_013456480.1 pathogenesis-related thaumatin family protein [Me... 69 4e-11 XP_012081740.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 69 4e-11 KHN10545.1 Thaumatin-like protein [Glycine soja] 64 5e-11 XP_018823897.1 PREDICTED: thaumatin-like protein 1b isoform X3 [... 68 5e-11 XP_002532701.1 PREDICTED: thaumatin-like protein 1b [Ricinus com... 68 5e-11 XP_016701870.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 68 6e-11 XP_017640952.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 68 6e-11 XP_018823896.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 68 6e-11 XP_018823895.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 68 6e-11 XP_017640951.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 68 7e-11 XP_016701869.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 68 7e-11 GAU30621.1 hypothetical protein TSUD_62410 [Trifolium subterraneum] 67 8e-11 ACE80961.1 putative allergen Pru p 2.03 [Prunus dulcis x Prunus ... 67 1e-10 KHN39890.1 Thaumatin-like protein [Glycine soja] 64 1e-10 XP_011655665.1 PREDICTED: thaumatin-like protein 1 [Cucumis sati... 67 1e-10 XP_018470926.1 PREDICTED: thaumatin-like protein 1b [Raphanus sa... 67 1e-10 >XP_010531541.1 PREDICTED: thaumatin-like protein 1b [Tarenaya hassleriana] Length = 309 Score = 69.7 bits (169), Expect = 1e-11 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P VC+PS+YSL FKHACP++++Y +DD ++ +C S +V++FCP P+ Sbjct: 204 YSTPDVCRPSVYSLFFKHACPRSYSYAYDDKTSTYTCASGADYVITFCPPPY 255 >XP_013456481.1 pathogenesis-related thaumatin family protein [Medicago truncatula] KEH30512.1 pathogenesis-related thaumatin family protein [Medicago truncatula] Length = 290 Score = 68.6 bits (166), Expect = 3e-11 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C S+DY +V FCP P+ Sbjct: 201 YSTPDTCGPSVYSLFFKHACPRAYSYAYDDKTSTYTCASADYLIV-FCPLPY 251 >XP_012081742.1 PREDICTED: thaumatin-like protein 1b isoform X3 [Jatropha curcas] KDP29624.1 hypothetical protein JCGZ_18786 [Jatropha curcas] Length = 318 Score = 68.6 bits (166), Expect = 4e-11 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C ++DY ++ FCP P+ Sbjct: 203 YSTPDTCSPSIYSLFFKHACPRAYSYAYDDKTSTYTCANTDYIII-FCPPPY 253 >XP_012081741.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Jatropha curcas] Length = 321 Score = 68.6 bits (166), Expect = 4e-11 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C ++DY ++ FCP P+ Sbjct: 233 YSTPDTCSPSIYSLFFKHACPRAYSYAYDDKTSTYTCANTDYIII-FCPPPY 283 >XP_013456480.1 pathogenesis-related thaumatin family protein [Medicago truncatula] KEH30511.1 pathogenesis-related thaumatin family protein [Medicago truncatula] Length = 326 Score = 68.6 bits (166), Expect = 4e-11 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C S+DY +V FCP P+ Sbjct: 201 YSTPDTCGPSVYSLFFKHACPRAYSYAYDDKTSTYTCASADYLIV-FCPLPY 251 >XP_012081740.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Jatropha curcas] Length = 348 Score = 68.6 bits (166), Expect = 4e-11 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C ++DY ++ FCP P+ Sbjct: 233 YSTPDTCSPSIYSLFFKHACPRAYSYAYDDKTSTYTCANTDYIII-FCPPPY 283 >KHN10545.1 Thaumatin-like protein [Glycine soja] Length = 87 Score = 63.9 bits (154), Expect = 5e-11 Identities = 24/50 (48%), Positives = 39/50 (78%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPN 150 Y +P CKP++YS FK ACPKA++Y +DDP+++ +C ++YF ++FCP+ Sbjct: 37 YGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYF-LTFCPH 85 >XP_018823897.1 PREDICTED: thaumatin-like protein 1b isoform X3 [Juglans regia] Length = 286 Score = 67.8 bits (164), Expect = 5e-11 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FK+ACP+A++Y +DD ++ +C S+DY ++ FCP+P+ Sbjct: 201 YSTPDTCGPSIYSLFFKYACPRAYSYAYDDKTSTYTCASADYMII-FCPSPY 251 >XP_002532701.1 PREDICTED: thaumatin-like protein 1b [Ricinus communis] EEF29686.1 Protein P21, putative [Ricinus communis] Length = 287 Score = 67.8 bits (164), Expect = 5e-11 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C +DY ++ FCP P+ Sbjct: 202 YSTPDTCSPSIYSLFFKHACPRAYSYAYDDKTSTYTCAKTDYLII-FCPLPY 252 >XP_016701870.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Gossypium hirsutum] Length = 288 Score = 67.8 bits (164), Expect = 6e-11 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 + P VC+PS YSL FKHACP+A++Y +DD ++ +C +DY V+ FCP PH Sbjct: 200 FRTPDVCRPSRYSLFFKHACPRAYSYAYDDTTSTYTCAGADY-VIMFCPPPH 250 >XP_017640952.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Gossypium arboreum] Length = 289 Score = 67.8 bits (164), Expect = 6e-11 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 + P VC+PS YSL FKHACP+A++Y +DD ++ +C +DY V+ FCP PH Sbjct: 200 FRTPDVCRPSRYSLFFKHACPRAYSYAYDDTTSTYTCAGADY-VIMFCPPPH 250 >XP_018823896.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Juglans regia] Length = 292 Score = 67.8 bits (164), Expect = 6e-11 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FK+ACP+A++Y +DD ++ +C S+DY ++ FCP+P+ Sbjct: 188 YSTPDTCGPSIYSLFFKYACPRAYSYAYDDKTSTYTCASADYMII-FCPSPY 238 >XP_018823895.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Juglans regia] Length = 305 Score = 67.8 bits (164), Expect = 6e-11 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FK+ACP+A++Y +DD ++ +C S+DY ++ FCP+P+ Sbjct: 201 YSTPDTCGPSIYSLFFKYACPRAYSYAYDDKTSTYTCASADYMII-FCPSPY 251 >XP_017640951.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Gossypium arboreum] Length = 314 Score = 67.8 bits (164), Expect = 7e-11 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 + P VC+PS YSL FKHACP+A++Y +DD ++ +C +DY V+ FCP PH Sbjct: 200 FRTPDVCRPSRYSLFFKHACPRAYSYAYDDTTSTYTCAGADY-VIMFCPPPH 250 >XP_016701869.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Gossypium hirsutum] Length = 314 Score = 67.8 bits (164), Expect = 7e-11 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 + P VC+PS YSL FKHACP+A++Y +DD ++ +C +DY V+ FCP PH Sbjct: 200 FRTPDVCRPSRYSLFFKHACPRAYSYAYDDTTSTYTCAGADY-VIMFCPPPH 250 >GAU30621.1 hypothetical protein TSUD_62410 [Trifolium subterraneum] Length = 259 Score = 67.0 bits (162), Expect = 8e-11 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C PS+YSL FKHACP+A++Y +DD ++ +C S++Y +V FCP P+ Sbjct: 202 YSTPDTCGPSVYSLLFKHACPRAYSYAYDDKTSTYTCASANYLIV-FCPLPY 252 >ACE80961.1 putative allergen Pru p 2.03 [Prunus dulcis x Prunus persica] Length = 260 Score = 66.6 bits (161), Expect = 1e-10 Identities = 25/52 (48%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 Y+ P C+PS++SL FKHACP+A++Y +DD ++ +C S+DY ++ FCP P+ Sbjct: 200 YATPDTCQPSVFSLFFKHACPRAYSYAYDDKTSTYTCASADYIII-FCPLPY 250 >KHN39890.1 Thaumatin-like protein [Glycine soja] Length = 119 Score = 63.9 bits (154), Expect = 1e-10 Identities = 25/52 (48%), Positives = 39/52 (75%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P +C PS YSL FKHACP+A++Y +DD ++ +C +++Y ++ FCP P+ Sbjct: 55 YSTPDMCGPSPYSLFFKHACPRAYSYAYDDKTSTYTCANANYLII-FCPFPY 105 >XP_011655665.1 PREDICTED: thaumatin-like protein 1 [Cucumis sativus] KGN51878.1 hypothetical protein Csa_5G604230 [Cucumis sativus] Length = 306 Score = 67.0 bits (162), Expect = 1e-10 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 +SNP+ C PS+YS FKHACPKA++Y +DD ++ +C + DY +V FCP+P+ Sbjct: 201 FSNPNTCHPSIYSSIFKHACPKAYSYAYDDGTSTFTCKAYDYTIV-FCPDPN 251 >XP_018470926.1 PREDICTED: thaumatin-like protein 1b [Raphanus sativus] Length = 273 Score = 66.6 bits (161), Expect = 1e-10 Identities = 25/52 (48%), Positives = 38/52 (73%) Frame = +1 Query: 1 YSNPHVCKPSLYSLRFKHACPKAFAYPFDDPSTLRSCPSSDYFVVSFCPNPH 156 YS P C+PS+YSL FKHACP+A++Y +DD ++ +C + +V+ FCP P+ Sbjct: 196 YSTPDTCQPSVYSLFFKHACPRAYSYAYDDKTSTYTCATGADYVIIFCPPPY 247