BLASTX nr result
ID: Ephedra29_contig00013237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00013237 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG57558.1 hypothetical protein 2_10052_01, partial [Pinus taeda] 52 4e-06 AEW08446.1 hypothetical protein 2_10052_01, partial [Pinus radia... 52 4e-06 >AFG57558.1 hypothetical protein 2_10052_01, partial [Pinus taeda] Length = 143 Score = 51.6 bits (122), Expect = 4e-06 Identities = 27/69 (39%), Positives = 41/69 (59%) Frame = -3 Query: 289 MKGCIGLKGSLDILGNLSSLRFLILSGCSGLEKLPEDLEEFLPRLFVIDIRCCDELIRNT 110 +KGC L+ + LGNL L+ LILSGCS L++LP+ +E L L + + CC L Sbjct: 17 LKGCFTLQRLSNSLGNLRGLQSLILSGCSSLQRLPDSIEN-LTSLRTLHLACCSNLEMLP 75 Query: 109 DLSKLMSMQ 83 ++ L S++ Sbjct: 76 NVGNLTSLR 84 >AEW08446.1 hypothetical protein 2_10052_01, partial [Pinus radiata] AFG57557.1 hypothetical protein 2_10052_01, partial [Pinus taeda] AFG57559.1 hypothetical protein 2_10052_01, partial [Pinus taeda] AFG57560.1 hypothetical protein 2_10052_01, partial [Pinus taeda] AFG57561.1 hypothetical protein 2_10052_01, partial [Pinus taeda] Length = 143 Score = 51.6 bits (122), Expect = 4e-06 Identities = 27/69 (39%), Positives = 41/69 (59%) Frame = -3 Query: 289 MKGCIGLKGSLDILGNLSSLRFLILSGCSGLEKLPEDLEEFLPRLFVIDIRCCDELIRNT 110 +KGC L+ + LGNL L+ LILSGCS L++LP+ +E L L + + CC L Sbjct: 17 LKGCFTLQRLSNSLGNLRGLQSLILSGCSSLQRLPDSIEN-LTSLRTLHLACCSNLEMLP 75 Query: 109 DLSKLMSMQ 83 ++ L S++ Sbjct: 76 NVGNLTSLR 84