BLASTX nr result
ID: Ephedra29_contig00012967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00012967 (965 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHA47128.1 ribosomal protein S4 (mitochondrion) [Amborella trich... 58 8e-06 >AHA47128.1 ribosomal protein S4 (mitochondrion) [Amborella trichopoda] Length = 354 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 570 KRKVQRIQLPTHYLEVNYRTMKAVVFDNPDFEFLPIQVKKALNNL 704 KR+++RI+LPTHYLEVNYRT+KAVVF PD +P ++ NL Sbjct: 289 KRRIKRIELPTHYLEVNYRTLKAVVFYGPDIGHIPHDIRLKDPNL 333