BLASTX nr result
ID: Ephedra29_contig00011790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00011790 (1762 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002523324.1 PREDICTED: uncharacterized protein At4g00950 [Ric... 59 4e-06 >XP_002523324.1 PREDICTED: uncharacterized protein At4g00950 [Ricinus communis] EEF39040.1 conserved hypothetical protein [Ricinus communis] Length = 239 Score = 58.9 bits (141), Expect = 4e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -1 Query: 727 ESQEHLRSPPRLPILTKPLWVLQAEASGMMTPPFGSAGSVPFKWEETPGKAKPSS 563 E++ S PRLP+ KP +V + SGM+TPP S+ +VPF+WEE PGK + S Sbjct: 4 EAEAEDSSTPRLPLFLKPPYVQSPQRSGMLTPPLYSSAAVPFRWEEEPGKPRECS 58