BLASTX nr result
ID: Ephedra29_contig00011262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00011262 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010241174.1 PREDICTED: cationic amino acid transporter 1-like... 79 3e-15 XP_010905430.1 PREDICTED: cationic amino acid transporter 1-like... 75 5e-14 ONK65186.1 uncharacterized protein A4U43_C07F34570 [Asparagus of... 72 7e-14 XP_008784883.2 PREDICTED: cationic amino acid transporter 1-like... 75 1e-13 XP_019711147.1 PREDICTED: cationic amino acid transporter 1-like... 74 2e-13 XP_009405465.1 PREDICTED: cationic amino acid transporter 1-like... 72 6e-13 XP_020096672.1 cationic amino acid transporter 1 [Ananas comosus] 72 6e-13 OAY77929.1 Cationic amino acid transporter 1 [Ananas comosus] 72 6e-13 OAY47198.1 hypothetical protein MANES_06G060400 [Manihot esculenta] 69 1e-12 XP_003535010.1 PREDICTED: cationic amino acid transporter 1-like... 71 2e-12 XP_009407711.1 PREDICTED: cationic amino acid transporter 1-like... 70 3e-12 XP_016504438.1 PREDICTED: cationic amino acid transporter 1-like... 70 3e-12 XP_009778011.1 PREDICTED: cationic amino acid transporter 1-like... 70 3e-12 XP_018828060.1 PREDICTED: cationic amino acid transporter 1-like... 70 4e-12 KDP26578.1 hypothetical protein JCGZ_17736 [Jatropha curcas] 67 6e-12 XP_015879826.1 PREDICTED: cationic amino acid transporter 1-like... 70 6e-12 KDO75318.1 hypothetical protein CISIN_1g007398mg [Citrus sinensis] 70 6e-12 XP_006468282.1 PREDICTED: cationic amino acid transporter 1 [Cit... 70 6e-12 XP_002281463.1 PREDICTED: cationic amino acid transporter 1 [Vit... 70 6e-12 CBI30990.3 unnamed protein product, partial [Vitis vinifera] 70 6e-12 >XP_010241174.1 PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera] XP_010241175.1 PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera] Length = 585 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G SKE FLPEESF+SWGNY +AL QTG RLKDR+L RSL E E+ E+ ARS+H Sbjct: 11 RGCSCSKEDFLPEESFKSWGNYAKALSQTGLRLKDRILTRSLDETEIHEIRARSQH 66 >XP_010905430.1 PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis] Length = 590 Score = 75.5 bits (184), Expect = 5e-14 Identities = 37/61 (60%), Positives = 46/61 (75%) Frame = +2 Query: 86 TMKGEKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSE 265 T+ +G SKE FLPE+SFESW +YG+AL++TG RL+DRV ARSL E E+ EV ARS Sbjct: 11 TVAKRRGCSCSKEDFLPEKSFESWASYGKALRETGMRLRDRVTARSLEETELHEVRARSG 70 Query: 266 H 268 H Sbjct: 71 H 71 >ONK65186.1 uncharacterized protein A4U43_C07F34570 [Asparagus officinalis] Length = 166 Score = 72.0 bits (175), Expect = 7e-14 Identities = 37/56 (66%), Positives = 40/56 (71%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 K G K FLPEESF+SW NY RALKQTG RL DRV ARS+ E E+ EV ARS H Sbjct: 11 KRRGCGKADFLPEESFQSWSNYARALKQTGPRLLDRVTARSMDETELNEVKARSGH 66 >XP_008784883.2 PREDICTED: cationic amino acid transporter 1-like, partial [Phoenix dactylifera] Length = 700 Score = 74.7 bits (182), Expect = 1e-13 Identities = 37/61 (60%), Positives = 46/61 (75%) Frame = +2 Query: 86 TMKGEKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSE 265 T +G +KE FLPE+SFESW +YG+AL++TGSRL+DRV ARSL E E+ EV ARS Sbjct: 8 TAAKRRGCSCTKEDFLPEKSFESWASYGQALRETGSRLRDRVTARSLDETELHEVRARSG 67 Query: 266 H 268 H Sbjct: 68 H 68 >XP_019711147.1 PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis] Length = 557 Score = 73.9 bits (180), Expect = 2e-13 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = +2 Query: 71 GVADRTMKGEKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEV 250 G+ K Y SK+ FLPEESF+SW NYGRAL++TG RL DR+ ARSL E+ EV Sbjct: 8 GIGGVVKKPRGCYSCSKKDFLPEESFQSWANYGRALRETGKRLGDRITARSLDRTELNEV 67 Query: 251 CARSEH 268 ARS H Sbjct: 68 RARSGH 73 >XP_009405465.1 PREDICTED: cationic amino acid transporter 1-like [Musa acuminata subsp. malaccensis] Length = 580 Score = 72.4 bits (176), Expect = 6e-13 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = +2 Query: 116 SKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +K+ FLPEESF+SW NYG+ALK+TG RLKDRV++RSL + E+ E+ ARS H Sbjct: 21 TKQDFLPEESFQSWANYGKALKETGMRLKDRVMSRSLDKSELTEIRARSGH 71 >XP_020096672.1 cationic amino acid transporter 1 [Ananas comosus] Length = 606 Score = 72.4 bits (176), Expect = 6e-13 Identities = 38/62 (61%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = +2 Query: 92 KGE---KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARS 262 KGE +G G SK FLPEESFESWG+YGRAL +TG RL+DR++ RS E+ EV ARS Sbjct: 13 KGEGRRRGCGCSKGDFLPEESFESWGSYGRALGETGRRLRDRIVTRSAESEEMHEVRARS 72 Query: 263 EH 268 H Sbjct: 73 GH 74 >OAY77929.1 Cationic amino acid transporter 1 [Ananas comosus] Length = 606 Score = 72.4 bits (176), Expect = 6e-13 Identities = 38/62 (61%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = +2 Query: 92 KGE---KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARS 262 KGE +G G SK FLPEESFESWG+YGRAL +TG RL+DR++ RS E+ EV ARS Sbjct: 13 KGEGRRRGCGCSKGDFLPEESFESWGSYGRALGETGRRLRDRIVTRSAESEEMHEVRARS 72 Query: 263 EH 268 H Sbjct: 73 GH 74 >OAY47198.1 hypothetical protein MANES_06G060400 [Manihot esculenta] Length = 150 Score = 68.6 bits (166), Expect = 1e-12 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G+ K FLPEESF+SWGNY RAL +T R KDR+L RS+ +E+ ++ ARSEH Sbjct: 20 RGFSCRKSDFLPEESFQSWGNYARALGETPMRFKDRLLTRSMDSMELNDMKARSEH 75 >XP_003535010.1 PREDICTED: cationic amino acid transporter 1-like [Glycine max] KRH37727.1 hypothetical protein GLYMA_09G084700 [Glycine max] Length = 594 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = +2 Query: 89 MKGEKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 M+ KG F K FLPEESF SWG+YGRAL +T RLKDR+L RS EV E+ ARS H Sbjct: 13 MRRRKGCTFQKNDFLPEESFGSWGSYGRALMETPRRLKDRILTRSNESAEVGEMRARSSH 72 >XP_009407711.1 PREDICTED: cationic amino acid transporter 1-like [Musa acuminata subsp. malaccensis] XP_009407712.1 PREDICTED: cationic amino acid transporter 1-like [Musa acuminata subsp. malaccensis] XP_009407713.1 PREDICTED: cationic amino acid transporter 1-like [Musa acuminata subsp. malaccensis] Length = 592 Score = 70.5 bits (171), Expect = 3e-12 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G +K+ F PEESF+SW NYGRAL++TG RL+DRV ARSL + E+ EV RS H Sbjct: 16 RGCSCTKDDFFPEESFKSWANYGRALRETGKRLRDRVTARSLEQSELHEVRLRSGH 71 >XP_016504438.1 PREDICTED: cationic amino acid transporter 1-like [Nicotiana tabacum] Length = 600 Score = 70.5 bits (171), Expect = 3e-12 Identities = 32/57 (56%), Positives = 46/57 (80%) Frame = +2 Query: 98 EKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 ++G G SK+ FLPEESF SWG+Y +AL++T +RLKDR+L+RS ++E+ EV RS+H Sbjct: 18 KRGCGCSKDDFLPEESFTSWGSYAQALRETKTRLKDRILSRSSDQLELHEVRDRSQH 74 >XP_009778011.1 PREDICTED: cationic amino acid transporter 1-like [Nicotiana sylvestris] Length = 600 Score = 70.5 bits (171), Expect = 3e-12 Identities = 32/57 (56%), Positives = 46/57 (80%) Frame = +2 Query: 98 EKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 ++G G SK+ FLPEESF SWG+Y +AL++T +RLKDR+L+RS ++E+ EV RS+H Sbjct: 18 KRGCGCSKDDFLPEESFTSWGSYAQALRETKTRLKDRILSRSSDQLELHEVRDRSQH 74 >XP_018828060.1 PREDICTED: cationic amino acid transporter 1-like [Juglans regia] XP_018828061.1 PREDICTED: cationic amino acid transporter 1-like [Juglans regia] XP_018828062.1 PREDICTED: cationic amino acid transporter 1-like [Juglans regia] XP_018828063.1 PREDICTED: cationic amino acid transporter 1-like [Juglans regia] Length = 584 Score = 70.1 bits (170), Expect = 4e-12 Identities = 32/57 (56%), Positives = 45/57 (78%) Frame = +2 Query: 98 EKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 ++G +K+ FLPE+SF+SWGNYGRAL +T RL+DRVL RS+ + E+ E+ ARS+H Sbjct: 8 KRGCSCTKDDFLPEKSFQSWGNYGRALMETPLRLRDRVLTRSMDQTELVEMKARSQH 64 >KDP26578.1 hypothetical protein JCGZ_17736 [Jatropha curcas] Length = 144 Score = 66.6 bits (161), Expect = 6e-12 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G +K FLPEESF+SWGNY +AL +T R KDR+L RS+ E+ E+ ARSEH Sbjct: 16 RGCSCTKNDFLPEESFQSWGNYMKALSETPMRFKDRLLTRSMDSTELHEIKARSEH 71 >XP_015879826.1 PREDICTED: cationic amino acid transporter 1-like isoform X1 [Ziziphus jujuba] XP_015879901.1 PREDICTED: cationic amino acid transporter 1-like isoform X2 [Ziziphus jujuba] XP_015882600.1 PREDICTED: cationic amino acid transporter 1-like [Ziziphus jujuba] Length = 605 Score = 69.7 bits (169), Expect = 6e-12 Identities = 35/66 (53%), Positives = 44/66 (66%) Frame = +2 Query: 71 GVADRTMKGEKGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEV 250 G D + +G +K+ FLPEESF SWGNY RALK+T R KDR+L RSL E+ E+ Sbjct: 8 GGRDEGVVRRRGCSCTKDDFLPEESFRSWGNYARALKETPIRFKDRLLTRSLDTTELVEM 67 Query: 251 CARSEH 268 ARS+H Sbjct: 68 KARSQH 73 >KDO75318.1 hypothetical protein CISIN_1g007398mg [Citrus sinensis] Length = 605 Score = 69.7 bits (169), Expect = 6e-12 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G +K FLPEESF SWGNY +ALK T RLKDRVL RSL E+ E+ ARSEH Sbjct: 13 RGCSCTKNDFLPEESFRSWGNYVQALKATPLRLKDRVLTRSLDTTEIHEIKARSEH 68 >XP_006468282.1 PREDICTED: cationic amino acid transporter 1 [Citrus sinensis] Length = 605 Score = 69.7 bits (169), Expect = 6e-12 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G +K FLPEESF SWGNY +ALK T RLKDRVL RSL E+ E+ ARSEH Sbjct: 13 RGCSCTKNDFLPEESFRSWGNYVQALKATPLRLKDRVLTRSLDTTEIHEIKARSEH 68 >XP_002281463.1 PREDICTED: cationic amino acid transporter 1 [Vitis vinifera] XP_003633038.1 PREDICTED: cationic amino acid transporter 1 [Vitis vinifera] Length = 606 Score = 69.7 bits (169), Expect = 6e-12 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G SK+ FLPEESF++WGNYGRAL + +RLKDR+L RSL E+ E+ ARS H Sbjct: 12 RGCSCSKDDFLPEESFKTWGNYGRALAEIPARLKDRLLTRSLDTTEMNEIKARSAH 67 >CBI30990.3 unnamed protein product, partial [Vitis vinifera] Length = 617 Score = 69.7 bits (169), Expect = 6e-12 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 101 KGYGFSKEYFLPEESFESWGNYGRALKQTGSRLKDRVLARSLAEIEVKEVCARSEH 268 +G SK+ FLPEESF++WGNYGRAL + +RLKDR+L RSL E+ E+ ARS H Sbjct: 36 RGCSCSKDDFLPEESFKTWGNYGRALAEIPARLKDRLLTRSLDTTEMNEIKARSAH 91