BLASTX nr result
ID: Ephedra29_contig00010945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00010945 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009343917.1 PREDICTED: uncharacterized protein LOC103935835 [... 52 3e-06 XP_008368796.1 PREDICTED: uncharacterized protein LOC103432385 [... 51 7e-06 >XP_009343917.1 PREDICTED: uncharacterized protein LOC103935835 [Pyrus x bretschneideri] Length = 322 Score = 52.4 bits (124), Expect = 3e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 201 MFDLIFNSGGSAPLSTDNLVTYVAEMPDGQALARQIIAN*PRR 73 + DLIF SGGS LST+ L YVA MPDG ALARQII + P + Sbjct: 279 LVDLIFESGGSTTLSTEGLRCYVAPMPDGVALARQIIHHHPSK 321 >XP_008368796.1 PREDICTED: uncharacterized protein LOC103432385 [Malus domestica] Length = 343 Score = 51.2 bits (121), Expect = 7e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 201 MFDLIFNSGGSAPLSTDNLVTYVAEMPDGQALARQIIAN*P 79 + DLIF SGGS LST+ L YVA MPDG ALARQI+ + P Sbjct: 300 LVDLIFKSGGSTTLSTEGLRCYVAPMPDGVALARQILHHHP 340