BLASTX nr result
ID: Ephedra29_contig00010592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00010592 (1256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN20655.1 hypothetical protein AMTR_s00070p00165510 [Amborella ... 59 6e-07 >ERN20655.1 hypothetical protein AMTR_s00070p00165510 [Amborella trichopoda] Length = 135 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/62 (46%), Positives = 43/62 (69%) Frame = +2 Query: 269 KVTVRGTHPTEDQAYSAAILEMVYELETAASQVLSKVRAIAKSQTLSLKDRLKSIQGCQS 448 K +V G + TEDQAY+AAI +++++E L K +AIA S+TL LK+RL+++ QS Sbjct: 30 KDSVHGVYKTEDQAYAAAIHNLIHDMEAVEGCRLPKKKAIAVSETLMLKERLQTVLAMQS 89 Query: 449 PE 454 PE Sbjct: 90 PE 91