BLASTX nr result
ID: Ephedra29_contig00010011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00010011 (787 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK22098.1 unknown [Picea sitchensis] 117 2e-29 GAQ78525.1 hypothetical protein KFL_000140450 [Klebsormidium fla... 97 1e-21 XP_001756061.1 predicted protein [Physcomitrella patens] EDQ7892... 97 2e-21 WP_073643164.1 hypothetical protein [Nostoc calcicola] OKH30619.... 57 1e-07 OBQ29324.1 hypothetical protein AN483_11210 [Aphanizomenon flos-... 57 1e-07 WP_040630842.1 hypothetical protein [Fortiea contorta] 57 2e-07 WP_012597226.1 MULTISPECIES: hypothetical protein [Cyanothece] A... 57 2e-07 WP_041041371.1 MULTISPECIES: hypothetical protein [Nostocales] K... 57 2e-07 WP_067769061.1 hypothetical protein [Nostoc sp. NIES-3756] BAT53... 57 2e-07 WP_015127788.1 hypothetical protein [Calothrix sp. PCC 7507] AFY... 56 3e-07 OBQ26221.1 hypothetical protein AN481_06310 [Aphanizomenon flos-... 56 3e-07 OBQ19778.1 hypothetical protein AN488_14130 [Anabaena sp. WA113]... 56 3e-07 WP_027403482.1 hypothetical protein [Aphanizomenon flos-aquae] 55 6e-07 WP_044304886.1 hypothetical protein [Richelia intracellularis] 55 9e-07 WP_015209974.1 hypothetical protein [Cylindrospermum stagnale] A... 55 1e-06 WP_026101786.1 hypothetical protein [cyanobacterium PCC 7702] 55 1e-06 OBQ08876.1 hypothetical protein AN482_12510 [Anabaena sp. 39865]... 55 1e-06 WP_019504880.1 hypothetical protein [Pleurocapsa sp. PCC 7319] 55 1e-06 WP_063871423.1 hypothetical protein [Nodularia spumigena] KZL513... 54 2e-06 ABA19807.1 conserved hypothetical protein [Anabaena variabilis A... 54 2e-06 >ABK22098.1 unknown [Picea sitchensis] Length = 140 Score = 117 bits (293), Expect = 2e-29 Identities = 72/147 (48%), Positives = 94/147 (63%), Gaps = 11/147 (7%) Frame = -3 Query: 722 MAAASAMLHTLPS-HTTAIAYR---------HTIPLS-HRSSTQQHKQLSLRRGTPYXXX 576 MA A A+LH++PS H A++ H IPL+ + ++ LS RR T Sbjct: 1 MACAYAVLHSIPSQHKKLEAFQPFTGLRRGLHGIPLNPFWNIGGRNHMLSGRRATK---- 56 Query: 575 XXXXSLQRRAALPVISAIPVVGPITNFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLV 396 +Q RA LPV+S IPVVGPI NFV +P +L +Y+ GAIRF SGFS+T +SDTL Sbjct: 57 ----RVQTRAGLPVVSNIPVVGPILNFVISPTLLIAIYVFGAIRFQSGFSRTIYSDTLAN 112 Query: 395 RFGLAAIWPVLFVISKRFRENFKKAVT 315 R GL AIWPVLF++SK FRENF++AV+ Sbjct: 113 RVGLTAIWPVLFLLSKAFRENFQRAVS 139 >GAQ78525.1 hypothetical protein KFL_000140450 [Klebsormidium flaccidum] Length = 148 Score = 97.1 bits (240), Expect = 1e-21 Identities = 46/78 (58%), Positives = 59/78 (75%) Frame = -3 Query: 551 RAALPVISAIPVVGPITNFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIW 372 RAALPV+S IPV+GP+ N V NP +L LY IGA RF G+ KTT+SD+ + L A+W Sbjct: 70 RAALPVVSGIPVLGPLANLVLNPVLLVALYAIGATRFWRGYPKTTYSDSGASKTTLTAMW 129 Query: 371 PVLFVISKRFRENFKKAV 318 PVLF++S+ +RENFKKAV Sbjct: 130 PVLFIVSQAYRENFKKAV 147 >XP_001756061.1 predicted protein [Physcomitrella patens] EDQ78927.1 predicted protein [Physcomitrella patens] Length = 151 Score = 96.7 bits (239), Expect = 2e-21 Identities = 43/79 (54%), Positives = 57/79 (72%) Frame = -3 Query: 551 RAALPVISAIPVVGPITNFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIW 372 RA LPVIS++PV+GP+ N V NP +L +Y GA RF SGF KTT++D + + A+W Sbjct: 73 RAGLPVISSVPVLGPLANAVFNPVLLFIVYAAGAFRFYSGFKKTTYADNSATKISMTALW 132 Query: 371 PVLFVISKRFRENFKKAVT 315 PVLF+ SK +R NFKKAV+ Sbjct: 133 PVLFIASKAYRNNFKKAVS 151 >WP_073643164.1 hypothetical protein [Nostoc calcicola] OKH30619.1 hypothetical protein FACHB389_23265 [Nostoc calcicola FACHB-389] Length = 62 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/61 (42%), Positives = 41/61 (67%) Frame = -3 Query: 500 NFVTNPFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKA 321 NF+ FVL +Y+ G +F +GF +T F+ TL R GL+ +WP LF+ ++ +R NF+KA Sbjct: 2 NFIV--FVLVVVYVGGVWKFWNGFGRTNFNPTLTNRIGLSLLWPALFITNQSYRRNFRKA 59 Query: 320 V 318 + Sbjct: 60 L 60 >OBQ29324.1 hypothetical protein AN483_11210 [Aphanizomenon flos-aquae MDT14a] Length = 63 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ G +F +GF+KT F+ TL R GLA +WP LF+++ +R NF+KA+ Sbjct: 7 FGLIVVYIAGVWKFWTGFNKTNFNQTLPNRIGLALLWPALFLVNPSYRRNFQKAL 61 >WP_040630842.1 hypothetical protein [Fortiea contorta] Length = 63 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 467 LYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 LY GA +F GF +T FS TL R GL+ +WP LF+I+K +R NF+KA+ Sbjct: 12 LYGYGAWKFWYGFERTNFSQTLPNRIGLSLLWPALFIINKSYRRNFQKAL 61 >WP_012597226.1 MULTISPECIES: hypothetical protein [Cyanothece] ACK67972.1 conserved hypothetical protein [Cyanothece sp. PCC 8801] ACV02868.1 conserved hypothetical protein [Cyanothece sp. PCC 8802] Length = 65 Score = 57.0 bits (136), Expect = 2e-07 Identities = 23/56 (41%), Positives = 39/56 (69%) Frame = -3 Query: 485 PFVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 PF++ +YL G +FV G++ T FS L + L+ +WPVLF+++ +R+NF+KA+ Sbjct: 6 PFIILVIYLAGVWKFVQGYNLTNFSRQLPTKLILSLLWPVLFIVNGSYRQNFQKAL 61 >WP_041041371.1 MULTISPECIES: hypothetical protein [Nostocales] KIJ74097.1 membrane protein [Tolypothrix campylonemoides VB511288] OKH61056.1 hypothetical protein NIES2130_00855 [Scytonema sp. HK-05] Length = 62 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y G +F+ GF++T F TL R GLA +WP LF+ SK +R+NF+KA+ Sbjct: 6 FGLVVVYAGGIWKFLGGFNRTNFQRTLPNRLGLALLWPALFMTSKSYRQNFRKAL 60 >WP_067769061.1 hypothetical protein [Nostoc sp. NIES-3756] BAT53697.1 hypothetical protein NOS3756_26580 [Nostoc sp. NIES-3756] Length = 63 Score = 56.6 bits (135), Expect = 2e-07 Identities = 24/55 (43%), Positives = 39/55 (70%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ GA +F +GFS+T FS +L R GL+ +WP LF+++ +R NF++A+ Sbjct: 7 FGLIVIYIGGAWKFWTGFSRTNFSQSLPNRIGLSLLWPALFIVNPSYRRNFRRAL 61 >WP_015127788.1 hypothetical protein [Calothrix sp. PCC 7507] AFY31970.1 hypothetical protein Cal7507_1506 [Calothrix sp. PCC 7507] Length = 62 Score = 56.2 bits (134), Expect = 3e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L LY GA +F GF +T FS TL R GL+ +WP LF+ +K +R NF+KA+ Sbjct: 6 FGLIALYGYGAWKFWYGFERTNFSQTLPNRIGLSLLWPALFITNKSYRRNFQKAL 60 >OBQ26221.1 hypothetical protein AN481_06310 [Aphanizomenon flos-aquae MDT13] Length = 63 Score = 56.2 bits (134), Expect = 3e-07 Identities = 24/55 (43%), Positives = 38/55 (69%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ G +F +GF+KT F+ TL R GLA +WP LF+++ +R NF++A+ Sbjct: 7 FGLIVVYIAGVWKFWTGFNKTNFNQTLPNRIGLALLWPALFLVNPSYRRNFQRAL 61 >OBQ19778.1 hypothetical protein AN488_14130 [Anabaena sp. WA113] OBQ42680.1 hypothetical protein AN484_16380 [Aphanizomenon flos-aquae WA102] Length = 63 Score = 56.2 bits (134), Expect = 3e-07 Identities = 24/55 (43%), Positives = 38/55 (69%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ G +F +GF+KT F+ TL R GLA +WP LF+++ +R NF++A+ Sbjct: 7 FGLIVVYIAGVWKFWTGFNKTNFNQTLPNRIGLALLWPALFLVNPSYRRNFQRAL 61 >WP_027403482.1 hypothetical protein [Aphanizomenon flos-aquae] Length = 63 Score = 55.5 bits (132), Expect = 6e-07 Identities = 23/55 (41%), Positives = 37/55 (67%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F + +Y+ G +F +GF +T F+ TL R GLA +WP LF+++ +R NF+KA+ Sbjct: 7 FAIIVVYIGGVWKFWTGFGRTNFNQTLPNRIGLALLWPALFLVNSSYRRNFQKAL 61 >WP_044304886.1 hypothetical protein [Richelia intracellularis] Length = 63 Score = 55.1 bits (131), Expect = 9e-07 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = -3 Query: 476 LSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 L +Y +G RF SGF KT FS LL R L+ +WP LF+ +K +R NF+KA+ Sbjct: 9 LIVVYAVGFWRFWSGFEKTNFSRRLLDRLILSLLWPALFIANKSYRTNFRKAL 61 >WP_015209974.1 hypothetical protein [Cylindrospermum stagnale] AFZ26736.1 hypothetical protein Cylst_4670 [Cylindrospermum stagnale PCC 7417] Length = 62 Score = 54.7 bits (130), Expect = 1e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y G +F +GF+KT F+ TL R GLA +WP LF+ + +R NF+KA+ Sbjct: 6 FGLLVVYAGGIWKFWTGFTKTNFTQTLPNRIGLALLWPALFIANSSYRRNFRKAL 60 >WP_026101786.1 hypothetical protein [cyanobacterium PCC 7702] Length = 63 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = -3 Query: 479 VLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 VL Y GA +F GF +TTFS +L R L+ +WP LF+ +K +R+NFKKA+ Sbjct: 8 VLIVGYAAGAWKFWRGFRRTTFSQSLSNRVTLSLLWPALFIANKSYRQNFKKAL 61 >OBQ08876.1 hypothetical protein AN482_12510 [Anabaena sp. 39865] OBQ14384.1 hypothetical protein AN490_00420 [Anabaena sp. 39864] Length = 64 Score = 54.7 bits (130), Expect = 1e-06 Identities = 25/55 (45%), Positives = 37/55 (67%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F + +YL G +F +GF +T F+ TL R GLA +WPVLF+ + +R NF+KA+ Sbjct: 7 FGIIVVYLGGVWKFWTGFGRTNFNQTLPNRIGLALLWPVLFLANPSYRRNFQKAL 61 >WP_019504880.1 hypothetical protein [Pleurocapsa sp. PCC 7319] Length = 64 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F+L +Y+ G +F+SGF +T F+ +L R LA +WPVL +K +R NF+KA+ Sbjct: 7 FILFLIYVGGIWKFLSGFRRTNFNSSLPGRITLALLWPVLLAANKSYRRNFRKAL 61 >WP_063871423.1 hypothetical protein [Nodularia spumigena] KZL51337.1 hypothetical protein A2T98_02515 [Nodularia spumigena CENA596] Length = 62 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ G + +GF +T FS TL R GL+ +WP LFV +K +R NF+KA+ Sbjct: 6 FGLLVVYVGGVWKLWTGFERTNFSQTLPNRLGLSLLWPALFVANKSYRRNFRKAL 60 >ABA19807.1 conserved hypothetical protein [Anabaena variabilis ATCC 29413] OBQ07924.1 hypothetical protein AN489_12020 [Anabaena sp. 39858] Length = 63 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -3 Query: 482 FVLSFLYLIGAIRFVSGFSKTTFSDTLLVRFGLAAIWPVLFVISKRFRENFKKAV 318 F L +Y+ G +F +GFS+T F+ +L + GLA +WP LFV + +R NF+KA+ Sbjct: 7 FGLIVIYIGGVWKFWNGFSRTNFTQSLPNKIGLALLWPALFVANSSYRRNFRKAL 61