BLASTX nr result
ID: Ephedra29_contig00009923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00009923 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019461030.1 PREDICTED: mediator of RNA polymerase II transcri... 45 6e-08 XP_019461031.1 PREDICTED: mediator of RNA polymerase II transcri... 45 6e-08 XP_019461032.1 PREDICTED: mediator of RNA polymerase II transcri... 45 6e-08 KHN42198.1 Putative mediator of RNA polymerase II transcription ... 44 1e-07 XP_006576321.1 PREDICTED: mediator of RNA polymerase II transcri... 44 1e-07 OEL13615.1 Mediator of RNA polymerase II transcription subunit 1... 44 1e-07 XP_010235445.1 PREDICTED: mediator of RNA polymerase II transcri... 41 6e-07 XP_014752317.1 PREDICTED: mediator of RNA polymerase II transcri... 41 6e-07 EMS47933.1 Putative mediator of RNA polymerase II transcription ... 42 6e-07 XP_018834307.1 PREDICTED: mediator of RNA polymerase II transcri... 42 1e-06 XP_020177067.1 mediator of RNA polymerase II transcription subun... 40 1e-06 EMT17889.1 Putative mediator of RNA polymerase II transcription ... 40 1e-06 XP_014497648.1 PREDICTED: mediator of RNA polymerase II transcri... 42 2e-06 XP_014497649.1 PREDICTED: mediator of RNA polymerase II transcri... 42 2e-06 ABD32834.1 2-oxo acid dehydrogenase, lipoyl-binding site [Medica... 44 2e-06 XP_003623963.2 RNA polymerase II transcription mediators protein... 44 2e-06 XP_006602801.1 PREDICTED: mediator of RNA polymerase II transcri... 44 3e-06 KHN29355.1 Putative mediator of RNA polymerase II transcription ... 44 3e-06 XP_006587851.1 PREDICTED: mediator of RNA polymerase II transcri... 44 3e-06 XP_014626319.1 PREDICTED: mediator of RNA polymerase II transcri... 44 3e-06 >XP_019461030.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Lupinus angustifolius] OIW02042.1 hypothetical protein TanjilG_21091 [Lupinus angustifolius] Length = 2240 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 ++ T+ L+ IY+VFFLCEWATC FR+ R P K K Sbjct: 537 KWFETISLSLIYSVFFLCEWATCDFRDFRTNPPCDIKFTGRK 578 Score = 39.3 bits (90), Expect(2) = 6e-08 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAHPAISSN 117 D K TG++D SQ++IAV ++ MKM+E++ + + + ++H A SN Sbjct: 571 DIKFTGRKDLSQVHIAVRLLKMKMREMKISPRLTNGRNQRVSHLAKCSN 619 >XP_019461031.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Lupinus angustifolius] Length = 2096 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 ++ T+ L+ IY+VFFLCEWATC FR+ R P K K Sbjct: 537 KWFETISLSLIYSVFFLCEWATCDFRDFRTNPPCDIKFTGRK 578 Score = 39.3 bits (90), Expect(2) = 6e-08 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAHPAISSN 117 D K TG++D SQ++IAV ++ MKM+E++ + + + ++H A SN Sbjct: 571 DIKFTGRKDLSQVHIAVRLLKMKMREMKISPRLTNGRNQRVSHLAKCSN 619 >XP_019461032.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X3 [Lupinus angustifolius] Length = 1832 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 ++ T+ L+ IY+VFFLCEWATC FR+ R P K K Sbjct: 129 KWFETISLSLIYSVFFLCEWATCDFRDFRTNPPCDIKFTGRK 170 Score = 39.3 bits (90), Expect(2) = 6e-08 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAHPAISSN 117 D K TG++D SQ++IAV ++ MKM+E++ + + + ++H A SN Sbjct: 163 DIKFTGRKDLSQVHIAVRLLKMKMREMKISPRLTNGRNQRVSHLAKCSN 211 >KHN42198.1 Putative mediator of RNA polymerase II transcription subunit 12 [Glycine soja] Length = 2227 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALP 268 ++ T+ A IY+VFFLCEWATC FR+ R P Sbjct: 535 KWFGTVNTALIYSVFFLCEWATCDFRDFRSTPP 567 Score = 39.3 bits (90), Expect(2) = 1e-07 Identities = 18/49 (36%), Positives = 35/49 (71%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAHPAISSN 117 D K TG++D SQ++IAV +++MK++++ K S+ T ++ +H A +S+ Sbjct: 569 DIKFTGRKDLSQVHIAVRLLLMKIRDV-KISQKQTNENHRASHLAKNSS 616 >XP_006576321.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628901.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628902.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] XP_014628903.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Glycine max] KRH65041.1 hypothetical protein GLYMA_03G009200 [Glycine max] KRH65042.1 hypothetical protein GLYMA_03G009200 [Glycine max] KRH65043.1 hypothetical protein GLYMA_03G009200 [Glycine max] Length = 2227 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALP 268 ++ T+ A IY+VFFLCEWATC FR+ R P Sbjct: 535 KWFGTVNTALIYSVFFLCEWATCDFRDFRSTPP 567 Score = 39.3 bits (90), Expect(2) = 1e-07 Identities = 18/49 (36%), Positives = 35/49 (71%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAHPAISSN 117 D K TG++D SQ++IAV +++MK++++ K S+ T ++ +H A +S+ Sbjct: 569 DIKFTGRKDLSQVHIAVRLLLMKIRDV-KISQKQTNENHRASHLAKNSS 616 >OEL13615.1 Mediator of RNA polymerase II transcription subunit 12, partial [Dichanthelium oligosanthes] Length = 2425 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 16/79 (20%) Frame = -3 Query: 257 KLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTK---SSNNI-----------AHPAI-- 126 K TG+RD +QIY+AVS++ KM E+ S++ + ++NNI A PA+ Sbjct: 450 KFTGRRDLTQIYVAVSILKNKMDEMNNLSRSKSSTRITTNNIVKGSSLNDACLAAPAVDD 509 Query: 125 SSN*LVTGREEKRDSNRLF 69 SS ++EK+D+N +F Sbjct: 510 SSGLKSNAKDEKKDTNDIF 528 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I ++FFLCEWATC +R+ R Sbjct: 415 WIGTVELSLICSIFFLCEWATCDYRDCR 442 >XP_010235445.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X1 [Brachypodium distachyon] KQK15196.1 hypothetical protein BRADI_1g21177 [Brachypodium distachyon] Length = 2178 Score = 41.2 bits (95), Expect(2) = 6e-07 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 D K TG+RD SQI++AVS++ KM EL S+ +KSS+ IA Sbjct: 535 DVKFTGRRDLSQIHMAVSILKSKMSELNNLSR--SKSSSRIA 574 Score = 39.3 bits (90), Expect(2) = 6e-07 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I +VFFLCEWATC +R+ R Sbjct: 502 WIGTVELSLICSVFFLCEWATCDYRDCR 529 >XP_014752317.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12 isoform X2 [Brachypodium distachyon] Length = 2176 Score = 41.2 bits (95), Expect(2) = 6e-07 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 D K TG+RD SQI++AVS++ KM EL S+ +KSS+ IA Sbjct: 533 DVKFTGRRDLSQIHMAVSILKSKMSELNNLSR--SKSSSRIA 572 Score = 39.3 bits (90), Expect(2) = 6e-07 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I +VFFLCEWATC +R+ R Sbjct: 500 WIGTVELSLICSVFFLCEWATCDYRDCR 527 >EMS47933.1 Putative mediator of RNA polymerase II transcription subunit 12 [Triticum urartu] Length = 2115 Score = 41.6 bits (96), Expect(2) = 6e-07 Identities = 21/40 (52%), Positives = 31/40 (77%) Frame = -3 Query: 257 KLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 K TG+RD+SQI++AVS++ KM E+ K S+ +KSS+ IA Sbjct: 530 KFTGRRDSSQIHLAVSILKSKMTEMNKLSR--SKSSSRIA 567 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I ++FFLCEWATC +R+ R Sbjct: 495 WIGTVELSLICSIFFLCEWATCDYRDCR 522 >XP_018834307.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834308.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834309.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834310.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834311.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834312.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834313.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834314.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834315.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834317.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] XP_018834318.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Juglans regia] Length = 2266 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEKRY 235 +++ T+ L+ I ++FFLCEWATC +R+ R P K + K + Sbjct: 552 KWIGTVNLSFICSIFFLCEWATCDYRDFRTVAPTNIKFSGRKDF 595 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 14/40 (35%), Positives = 30/40 (75%) Frame = -3 Query: 257 KLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 K +G++D Q+YIAV ++ +K+K+LQ++S+ + S+ ++ Sbjct: 588 KFSGRKDFCQVYIAVRILKLKIKDLQRSSRGKSGSTLGVS 627 >XP_020177067.1 mediator of RNA polymerase II transcription subunit 12 [Aegilops tauschii subsp. tauschii] Length = 2208 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = -3 Query: 257 KLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 K TG+RD SQI++AVS++ KM E+ K S+ +KSS+ IA Sbjct: 570 KFTGRRDLSQIHLAVSILKNKMTEMNKLSR--SKSSSRIA 607 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I ++FFLCEWATC +R+ R Sbjct: 535 WIGTVELSLICSIFFLCEWATCDYRDCR 562 >EMT17889.1 Putative mediator of RNA polymerase II transcription subunit 12 [Aegilops tauschii] Length = 2117 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 21/40 (52%), Positives = 30/40 (75%) Frame = -3 Query: 257 KLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIA 138 K TG+RD SQI++AVS++ KM E+ K S+ +KSS+ IA Sbjct: 546 KFTGRRDLSQIHLAVSILKNKMTEMNKLSR--SKSSSRIA 583 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -2 Query: 363 FMNTLELAKIYAVFFLCEWATCCFRNHR 280 ++ T+EL+ I ++FFLCEWATC +R+ R Sbjct: 511 WIGTVELSLICSIFFLCEWATCDYRDCR 538 >XP_014497648.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Vigna radiata var. radiata] Length = 2258 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDA 274 ++ T+ + IY+VFFLCEWATC FR+ R A Sbjct: 549 KWFRTVNTSFIYSVFFLCEWATCDFRDFRTA 579 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 16/43 (37%), Positives = 30/43 (69%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAH 135 D K TG++D SQ++IA+ ++ MK++++Q +++ KS N H Sbjct: 582 DVKFTGRKDLSQVHIAIRLLKMKLRDMQISTRQ--KSGNTRGH 622 >XP_014497649.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Vigna radiata var. radiata] Length = 2216 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = -2 Query: 366 RFMNTLELAKIYAVFFLCEWATCCFRNHRDA 274 ++ T+ + IY+VFFLCEWATC FR+ R A Sbjct: 507 KWFRTVNTSFIYSVFFLCEWATCDFRDFRTA 537 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 16/43 (37%), Positives = 30/43 (69%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNNIAH 135 D K TG++D SQ++IA+ ++ MK++++Q +++ KS N H Sbjct: 540 DVKFTGRKDLSQVHIAIRLLKMKLRDMQISTRQ--KSGNTRGH 580 >ABD32834.1 2-oxo acid dehydrogenase, lipoyl-binding site [Medicago truncatula] Length = 2270 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 336 IYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 IY+VFFLCEWATC FRN R A P K +K Sbjct: 575 IYSVFFLCEWATCDFRNFRTAPPCDIKFTGKK 606 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNN 144 D K TGK+D SQ++IAV ++ MK++ + S S+++ Sbjct: 599 DIKFTGKKDISQVHIAVRILKMKLRNMHTLSTQMNGSTHH 638 >XP_003623963.2 RNA polymerase II transcription mediators protein [Medicago truncatula] AES80181.2 RNA polymerase II transcription mediators protein [Medicago truncatula] Length = 2257 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 336 IYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 IY+VFFLCEWATC FRN R A P K +K Sbjct: 562 IYSVFFLCEWATCDFRNFRTAPPCDIKFTGKK 593 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSSNN 144 D K TGK+D SQ++IAV ++ MK++ + S S+++ Sbjct: 586 DIKFTGKKDISQVHIAVRILKMKLRNMHTLSTQMNGSTHH 625 >XP_006602801.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] XP_006602802.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] XP_014626318.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] KRH00746.1 hypothetical protein GLYMA_18G232900 [Glycine max] KRH00747.1 hypothetical protein GLYMA_18G232900 [Glycine max] Length = 2266 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 354 TLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 T+ + +Y+VFFLCEWATC FR+ R+A P K K Sbjct: 556 TVNKSLVYSVFFLCEWATCDFRDFRNAPPCDVKFTGRK 593 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/38 (34%), Positives = 28/38 (73%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSS 150 D K TG++D S ++IA+ ++ MK++++Q + K+ + S+ Sbjct: 586 DVKFTGRKDLSHVHIAIRLLKMKLRDMQISPKHKSGST 623 >KHN29355.1 Putative mediator of RNA polymerase II transcription subunit 12 [Glycine soja] Length = 2259 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 354 TLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 T+ + +Y+VFFLCEWATC FR+ R+A P K K Sbjct: 556 TVNKSLVYSVFFLCEWATCDFRDFRNAPPCDVKFTGRK 593 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/38 (34%), Positives = 28/38 (73%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSS 150 D K TG++D SQ++IA+ ++ +K++++Q + K + S+ Sbjct: 586 DVKFTGRKDLSQVHIAIRLLKVKLRDMQISPKQKSGST 623 >XP_006587851.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] XP_014617897.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] XP_014617898.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] KRH40454.1 hypothetical protein GLYMA_09G259400 [Glycine max] KRH40455.1 hypothetical protein GLYMA_09G259400 [Glycine max] KRH40456.1 hypothetical protein GLYMA_09G259400 [Glycine max] Length = 2259 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 354 TLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 T+ + +Y+VFFLCEWATC FR+ R+A P K K Sbjct: 556 TVNKSLVYSVFFLCEWATCDFRDFRNAPPCDVKFTGRK 593 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/38 (34%), Positives = 28/38 (73%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSS 150 D K TG++D SQ++IA+ ++ +K++++Q + K + S+ Sbjct: 586 DVKFTGRKDLSQVHIAIRLLKVKLRDMQISPKQKSGST 623 >XP_014626319.1 PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Glycine max] KRH00745.1 hypothetical protein GLYMA_18G232900 [Glycine max] Length = 2246 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = -2 Query: 354 TLELAKIYAVFFLCEWATCCFRNHRDALPVGQKVNWEK 241 T+ + +Y+VFFLCEWATC FR+ R+A P K K Sbjct: 536 TVNKSLVYSVFFLCEWATCDFRDFRNAPPCDVKFTGRK 573 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/38 (34%), Positives = 28/38 (73%) Frame = -3 Query: 263 DKKLTGKRDTSQIYIAVSVMIMKMKELQKASKNDTKSS 150 D K TG++D S ++IA+ ++ MK++++Q + K+ + S+ Sbjct: 566 DVKFTGRKDLSHVHIAIRLLKMKLRDMQISPKHKSGST 603