BLASTX nr result
ID: Ephedra29_contig00009380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00009380 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003626131.1 low temperature and salt responsive family protei... 69 2e-12 XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume... 66 1e-11 XP_014754368.1 PREDICTED: hydrophobic protein RCI2B-like [Brachy... 66 1e-11 XP_009124956.1 PREDICTED: hydrophobic protein RCI2B [Brassica ra... 66 2e-11 XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus pe... 66 3e-11 XP_010694118.1 PREDICTED: hydrophobic protein RCI2B [Beta vulgar... 65 3e-11 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 65 5e-11 AFI47457.1 low temperature and salt responsive protein [Medicago... 65 5e-11 AAQ84111.1 Clt1 [Citrus trifoliata] 65 5e-11 KMZ66926.1 Hydrophobic protein RCI2B [Zostera marina] 65 5e-11 XP_010094907.1 Hydrophobic protein LTI6A [Morus notabilis] EXB57... 65 5e-11 XP_001776246.1 predicted protein [Physcomitrella patens] AAR8765... 65 5e-11 XP_019098751.1 PREDICTED: hydrophobic protein RCI2B, partial [Ca... 64 7e-11 XP_009134856.1 PREDICTED: hydrophobic protein RCI2A-like [Brassi... 64 7e-11 XP_018820962.1 PREDICTED: hydrophobic protein LTI6B-like [Juglan... 64 9e-11 XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Cameli... 64 9e-11 XP_003626132.1 low temperature and salt responsive family protei... 64 9e-11 XP_002318921.1 hypothetical protein POPTR_0013s00340g [Populus t... 64 9e-11 NP_187240.1 Low temperature and salt responsive protein family [... 64 9e-11 XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer ariet... 64 9e-11 >XP_003626131.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33189.1 Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] AES82349.1 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 68.6 bits (166), Expect = 2e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF LE EFWICL+LTL GYLPGIIYA+YIIT+ Sbjct: 19 GVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume] ONI04114.1 hypothetical protein PRUPE_6G303600 [Prunus persica] Length = 54 Score = 66.2 bits (160), Expect = 1e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF E EFWICLILTL GYLPGIIYA+YI+T+ Sbjct: 19 GVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 54 >XP_014754368.1 PREDICTED: hydrophobic protein RCI2B-like [Brachypodium distachyon] KQK04001.1 hypothetical protein BRADI_2g11135 [Brachypodium distachyon] Length = 56 Score = 66.2 bits (160), Expect = 1e-11 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +1 Query: 139 MSRDTDKXXXXXXXXXXXXXGVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 MS T+K GV LKF +TEFW+CL+LTL GYLPGIIYAVY++T+ Sbjct: 1 MSNSTEKCVSIVLAIILPPLGVLLKFGCQTEFWLCLLLTLFGYLPGIIYAVYVLTK 56 >XP_009124956.1 PREDICTED: hydrophobic protein RCI2B [Brassica rapa] XP_013624616.1 PREDICTED: hydrophobic protein RCI2B [Brassica oleracea var. oleracea] XP_013647887.1 PREDICTED: hydrophobic protein RCI2B [Brassica napus] XP_013725410.1 PREDICTED: hydrophobic protein RCI2B [Brassica napus] XP_018441125.1 PREDICTED: hydrophobic protein RCI2B [Raphanus sativus] Length = 55 Score = 65.9 bits (159), Expect = 2e-11 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF L+ EFWICLILTL GYLPGI+YA+YIIT+ Sbjct: 19 GVFLKFGLKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 66.2 bits (160), Expect = 3e-11 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF E EFWICLILTL GYLPGIIYA+YI+T+ Sbjct: 58 GVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >XP_010694118.1 PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] KMS98601.1 hypothetical protein BVRB_3g070440 [Beta vulgaris subsp. vulgaris] Length = 54 Score = 65.1 bits (157), Expect = 3e-11 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF +ETEFWIC++ T GYLPGIIYAVY+IT+ Sbjct: 19 GVFLKFGIETEFWICVVCTFFGYLPGIIYAVYVITK 54 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 64.7 bits (156), Expect = 5e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF E EFWICL+LTL GYLPGIIYA+Y IT+ Sbjct: 19 GVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >AFI47457.1 low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 64.7 bits (156), Expect = 5e-11 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICLILT+LGYLPGI+YA+Y+IT+ Sbjct: 19 GVFLKFGCNVEFWICLILTILGYLPGILYAIYVITK 54 >AAQ84111.1 Clt1 [Citrus trifoliata] Length = 54 Score = 64.7 bits (156), Expect = 5e-11 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF + EFWICL+LT+LGY+PGIIYAVY+IT+ Sbjct: 19 GVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >KMZ66926.1 Hydrophobic protein RCI2B [Zostera marina] Length = 55 Score = 64.7 bits (156), Expect = 5e-11 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF+ + +FWICL+LTL GY+PGIIYA+Y+IT+ Sbjct: 19 GVFLKFKFQVQFWICLLLTLFGYIPGIIYAIYVITK 54 >XP_010094907.1 Hydrophobic protein LTI6A [Morus notabilis] EXB57550.1 Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 64.7 bits (156), Expect = 5e-11 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICL+LTL GYLPGIIYAVYIIT+ Sbjct: 22 GVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >XP_001776246.1 predicted protein [Physcomitrella patens] AAR87655.1 small hydrophobic protein 1 [Physcomitrella patens] EDQ58879.1 predicted protein [Physcomitrella patens] Length = 59 Score = 64.7 bits (156), Expect = 5e-11 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYII 300 GVFLK+ L++EFWICL+LT+LGYLPGIIYA+Y+I Sbjct: 24 GVFLKYGLQSEFWICLVLTILGYLPGIIYAIYVI 57 >XP_019098751.1 PREDICTED: hydrophobic protein RCI2B, partial [Camelina sativa] Length = 37 Score = 63.9 bits (154), Expect = 7e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF + EFWICLILTL GYLPGI+YA+YIIT+ Sbjct: 2 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 37 >XP_009134856.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] XP_013740935.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] CDX74126.1 BnaA03g29210D [Brassica napus] Length = 55 Score = 64.3 bits (155), Expect = 7e-11 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICLILTLLGY+PGIIYAVY IT+ Sbjct: 19 GVFLKFGCSVEFWICLILTLLGYIPGIIYAVYAITR 54 >XP_018820962.1 PREDICTED: hydrophobic protein LTI6B-like [Juglans regia] Length = 53 Score = 63.9 bits (154), Expect = 9e-11 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF + EFWICL+LT+LGY+PGIIYAVY IT+ Sbjct: 18 GVFLKFGCQVEFWICLLLTILGYIPGIIYAVYAITE 53 >XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019091984.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019096126.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] Length = 54 Score = 63.9 bits (154), Expect = 9e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF + EFWICLILTL GYLPGI+YA+YIIT+ Sbjct: 19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_003626132.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33197.1 Protein of unknown function UPF0057 [Medicago truncatula] AES82350.1 low temperature and salt responsive family protein [Medicago truncatula] AFK36815.1 unknown [Medicago truncatula] Length = 54 Score = 63.9 bits (154), Expect = 9e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICLILT+LGYLPGIIYA+Y IT+ Sbjct: 19 GVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >XP_002318921.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] XP_006375707.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] XP_006375708.1 Hydrophobic protein RCI2A [Populus trichocarpa] XP_006375709.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] EEE94844.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] ERP53504.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] ERP53505.1 Hydrophobic protein RCI2A [Populus trichocarpa] ERP53506.1 hypothetical protein POPTR_0013s00340g [Populus trichocarpa] Length = 54 Score = 63.9 bits (154), Expect = 9e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICL+LT+LGY+PGIIYAVYIIT+ Sbjct: 19 GVFLKFGCGAEFWICLLLTILGYIPGIIYAVYIITK 54 >NP_187240.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNS6.1 RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B AAF23227.1 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] AAK50618.1 hydrophobic protein RCI2B [Arabidopsis thaliana] AAC97511.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AAD17303.1 hydrophobic protein [Arabidopsis thaliana] AAM61275.1 hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] BAD44016.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] ABG25095.1 At3g05890 [Arabidopsis thaliana] BAF00618.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AEE74312.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP04511.1 RCI2B [Arabidopsis thaliana] Length = 54 Score = 63.9 bits (154), Expect = 9e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF + EFWICLILTL GYLPGI+YA+YIIT+ Sbjct: 19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 63.9 bits (154), Expect = 9e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 199 GVFLKFRLETEFWICLILTLLGYLPGIIYAVYIITQ 306 GVFLKF EFWICLILT+LGYLPGIIYA+Y IT+ Sbjct: 19 GVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54