BLASTX nr result
ID: Ephedra29_contig00009361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00009361 (490 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR18212.1 unknown [Picea sitchensis] 53 8e-09 >ABR18212.1 unknown [Picea sitchensis] Length = 323 Score = 53.1 bits (126), Expect(2) = 8e-09 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 202 MSQPRVTITLGRNGGVVQRAACLADERDSDKERLSGKKRP 321 MS+PRVTITLGR+G VVQR A + DER SD+ L+ +KRP Sbjct: 1 MSRPRVTITLGRSGQVVQRPASIPDERHSDQIPLTSRKRP 40 Score = 33.9 bits (76), Expect(2) = 8e-09 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Frame = +3 Query: 330 DSASHHGDQIDAKRQRNQS-------DQNRSYNHRGNGDTKVDAHDLRYKLLRRRSSQ 482 D+ S + Q + KRQR D N+ N + KVD DLR KLLR++ S+ Sbjct: 50 DNTSSYDHQNNLKRQRRDQRSWKYPHDNNKDGNALQFSNGKVDVQDLRMKLLRKKPSR 107