BLASTX nr result
ID: Ephedra29_contig00008699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00008699 (716 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAE30453.1 hypothetical protein AXG93_2121s1270 [Marchantia poly... 69 3e-11 >OAE30453.1 hypothetical protein AXG93_2121s1270 [Marchantia polymorpha subsp. polymorpha] Length = 130 Score = 68.9 bits (167), Expect = 3e-11 Identities = 36/65 (55%), Positives = 45/65 (69%) Frame = +1 Query: 229 IAVRGMTALKDAGSFAIRVFAQVSAMKAGELSQSIASQGSDVGCCYVSVEDACTAGCNSA 408 IAV+G+TAL+ AG IRVFAQ+ G QS+A+QG V CCY+ VEDAC GC +A Sbjct: 12 IAVKGITALEQAGRHTIRVFAQIE----GLCKQSMATQGEAV-CCYIFVEDACETGCATA 66 Query: 409 CHRAT 423 C RA+ Sbjct: 67 CERAS 71