BLASTX nr result
ID: Ephedra29_contig00007833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00007833 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW87590.1 hypothetical protein EUGRSUZ_B040321, partial [Eucaly... 80 1e-18 OIV91967.1 hypothetical protein TanjilG_26489 [Lupinus angustifo... 79 9e-18 ACA58350.1 putative 26S proteasome regulatory complex protein, p... 77 3e-17 ACA61610.1 hypothetical protein AP2_E06.1, partial [Arabidopsis ... 80 3e-17 KDO36506.1 hypothetical protein CISIN_1g030674mg [Citrus sinensis] 79 1e-16 XP_009592167.1 PREDICTED: 26S protease regulatory subunit 6B hom... 79 1e-16 KDO36507.1 hypothetical protein CISIN_1g030674mg [Citrus sinensis] 79 1e-16 CAA06853.1 26S protease regulatory subunit 6, partial [Cicer ari... 79 1e-16 EMT26026.1 hypothetical protein F775_44040 [Aegilops tauschii] 77 1e-16 ADE75925.1 unknown [Picea sitchensis] 79 2e-16 CDP04036.1 unnamed protein product [Coffea canephora] 80 3e-16 EPS61927.1 hypothetical protein M569_12866, partial [Genlisea au... 74 5e-16 XP_019577067.1 PREDICTED: 26S protease regulatory subunit 6B hom... 80 5e-16 XP_006401107.1 hypothetical protein EUTSA_v10013708mg [Eutrema s... 80 5e-16 NP_200637.1 regulatory particle triple-A ATPase 3 [Arabidopsis t... 80 5e-16 XP_010453468.1 PREDICTED: 26S protease regulatory subunit 6B hom... 80 5e-16 XP_010045430.1 PREDICTED: 26S protease regulatory subunit 6B hom... 80 5e-16 XP_010252000.1 PREDICTED: 26S protease regulatory subunit 6B hom... 80 5e-16 XP_010244563.1 PREDICTED: 26S protease regulatory subunit 6B hom... 80 5e-16 EOY19210.1 Regulatory particle triple-A ATPase 3 isoform 2, part... 79 9e-16 >KCW87590.1 hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] KCW87591.1 hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] KCW87592.1 hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] Length = 44 Score = 80.1 bits (196), Expect = 1e-18 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 8 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 44 >OIV91967.1 hypothetical protein TanjilG_26489 [Lupinus angustifolius] Length = 67 Score = 78.6 bits (192), Expect = 9e-18 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 31 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 67 >ACA58350.1 putative 26S proteasome regulatory complex protein, partial [Sandersonia aurantiaca] Length = 71 Score = 77.4 bits (189), Expect = 3e-17 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+F+FYK Sbjct: 35 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK 71 >ACA61610.1 hypothetical protein AP2_E06.1, partial [Arabidopsis lyrata subsp. petraea] Length = 172 Score = 80.1 bits (196), Expect = 3e-17 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 136 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 172 >KDO36506.1 hypothetical protein CISIN_1g030674mg [Citrus sinensis] Length = 168 Score = 78.6 bits (192), Expect = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 132 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 168 >XP_009592167.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana tomentosiformis] Length = 173 Score = 78.6 bits (192), Expect = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 137 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 173 >KDO36507.1 hypothetical protein CISIN_1g030674mg [Citrus sinensis] Length = 173 Score = 78.6 bits (192), Expect = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 137 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 173 >CAA06853.1 26S protease regulatory subunit 6, partial [Cicer arietinum] Length = 177 Score = 78.6 bits (192), Expect = 1e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 141 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 177 >EMT26026.1 hypothetical protein F775_44040 [Aegilops tauschii] Length = 135 Score = 77.4 bits (189), Expect = 1e-16 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+F+FYK Sbjct: 99 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK 135 >ADE75925.1 unknown [Picea sitchensis] Length = 214 Score = 79.0 bits (193), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+F+FYK Sbjct: 178 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 214 >CDP04036.1 unnamed protein product [Coffea canephora] Length = 326 Score = 80.1 bits (196), Expect = 3e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 290 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 326 >EPS61927.1 hypothetical protein M569_12866, partial [Genlisea aurea] Length = 71 Score = 74.3 bits (181), Expect = 5e-16 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFY 114 AGMHAVRKNRYVILPKDFEKGYR+NVKKPD++F+FY Sbjct: 36 AGMHAVRKNRYVILPKDFEKGYRSNVKKPDSDFDFY 71 >XP_019577067.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Rhinolophus sinicus] Length = 404 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 368 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 404 >XP_006401107.1 hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] ESQ42560.1 hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] Length = 404 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 368 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 404 >NP_200637.1 regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] XP_002864561.1 hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] XP_006279634.1 hypothetical protein CARUB_v10026512mg [Capsella rubella] Q9SEI4.1 RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 AAF22523.1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] BAA96920.1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] AAL49932.1 AT4g10340/F24G24_140 [Arabidopsis thaliana] AAV85728.1 At5g58290 [Arabidopsis thaliana] EFH40820.1 hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] AED97029.1 regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] EOA12532.1 hypothetical protein CARUB_v10026512mg [Capsella rubella] OAO90157.1 RPT3 [Arabidopsis thaliana] Length = 408 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 372 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >XP_010453468.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] XP_010443548.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] XP_010483400.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] Length = 408 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 372 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >XP_010045430.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Eucalyptus grandis] Length = 414 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 378 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 414 >XP_010252000.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo nucifera] Length = 420 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 384 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 420 >XP_010244563.1 PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo nucifera] Length = 421 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYRANVKKPDT+FEFYK Sbjct: 385 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 421 >EOY19210.1 Regulatory particle triple-A ATPase 3 isoform 2, partial [Theobroma cacao] Length = 291 Score = 78.6 bits (192), Expect = 9e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 221 AGMHAVRKNRYVILPKDFEKGYRANVKKPDTEFEFYK 111 AGMHAVRKNRYVILPKDFEKGYR NVKKPDT+FEFYK Sbjct: 255 AGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 291