BLASTX nr result
ID: Ephedra29_contig00007739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00007739 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006856239.1 PREDICTED: lysine histidine transporter-like 8 [A... 74 2e-13 OAE20091.1 hypothetical protein AXG93_544s1050 [Marchantia polym... 57 2e-07 XP_018806190.1 PREDICTED: lysine histidine transporter-like 8 [J... 55 9e-07 AFK39063.1 unknown [Medicago truncatula] 54 1e-06 GAU22690.1 hypothetical protein TSUD_235120, partial [Trifolium ... 54 2e-06 XP_018855333.1 PREDICTED: lysine histidine transporter-like 8 [J... 54 2e-06 XP_004512243.1 PREDICTED: lysine histidine transporter-like 8 [C... 54 2e-06 XP_003612282.1 transmembrane amino acid transporter family prote... 54 2e-06 KZM96239.1 hypothetical protein DCAR_019481 [Daucus carota subsp... 53 4e-06 KFK29080.1 hypothetical protein AALP_AA7G086300 [Arabis alpina] 53 4e-06 XP_003635214.1 PREDICTED: lysine histidine transporter-like 8 [V... 53 4e-06 XP_017254121.1 PREDICTED: lysine histidine transporter-like 8 [D... 53 4e-06 CBI38472.3 unnamed protein product, partial [Vitis vinifera] 53 4e-06 >XP_006856239.1 PREDICTED: lysine histidine transporter-like 8 [Amborella trichopoda] ERN17706.1 hypothetical protein AMTR_s00059p00214190 [Amborella trichopoda] Length = 547 Score = 73.9 bits (180), Expect = 2e-13 Identities = 44/68 (64%), Positives = 50/68 (73%), Gaps = 4/68 (5%) Frame = -2 Query: 192 VGNSHSLSLSHQTPASTRP-PSSLVSPSMPRSPL--LKTPRTPWTPS-LISPRFLSPIGT 25 + +SHS +++ S RP SSL+S S P SP LKTPRTPWTPS LISPRFLSPIGT Sbjct: 29 LSSSHSHAVTPSGQRSPRPLSSSLISLSNPASPPPPLKTPRTPWTPSSLISPRFLSPIGT 88 Query: 24 PMKRVLSN 1 PMKRVL N Sbjct: 89 PMKRVLVN 96 >OAE20091.1 hypothetical protein AXG93_544s1050 [Marchantia polymorpha subsp. polymorpha] Length = 611 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -2 Query: 153 PASTRPPSSLVSPSMPRSPLLKTPRTPWTPSLISPRFL-SPIGTPMKRVLSN 1 P S++ PSSL +PS+P TP+TPWTP L SPRFL +P+ TPM+R N Sbjct: 112 PGSSKAPSSLPTPSLP------TPKTPWTPGLRSPRFLGTPLATPMRRAFVN 157 >XP_018806190.1 PREDICTED: lysine histidine transporter-like 8 [Juglans regia] Length = 532 Score = 55.1 bits (131), Expect = 9e-07 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 12/62 (19%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLL-----------KTPRTPWTPSL-ISPRFLSPIGTPMKR 13 TP + PPS SPS+ RSPLL KTP+TP TP L ++PRF++P+G+PM++ Sbjct: 28 TPPVSCPPSQFHSPSLSRSPLLHEEHAAEAPRNKTPKTPRTPRLSLTPRFITPLGSPMRK 87 Query: 12 VL 7 L Sbjct: 88 AL 89 >AFK39063.1 unknown [Medicago truncatula] Length = 294 Score = 54.3 bits (129), Expect = 1e-06 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 13/74 (17%) Frame = -2 Query: 189 GNSHSLSLSHQTPASTRPPSSLVSPSMPRSPLL------------KTPRTPWTPSL-ISP 49 GNS + +P + PPS L SPS+ RSPLL KTP+TP TP + ++P Sbjct: 17 GNSLMGTPRVASPPVSCPPSQLHSPSLTRSPLLQSENGDAPHPKSKTPKTPRTPRMSLTP 76 Query: 48 RFLSPIGTPMKRVL 7 RF++P+G+PM++ L Sbjct: 77 RFITPLGSPMRKAL 90 >GAU22690.1 hypothetical protein TSUD_235120, partial [Trifolium subterraneum] Length = 478 Score = 54.3 bits (129), Expect = 2e-06 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 16/77 (20%) Frame = -2 Query: 189 GNSHSLSLSHQTPASTRPPSSLVSPSMPRSPLL---------------KTPRTPWTPSL- 58 GNS + +P + PPS L SPS+ RSPLL KTPRTP TP + Sbjct: 17 GNSLLGTPMVSSPPVSCPPSQLHSPSLTRSPLLQSENGDVIHPKSKTPKTPRTPRTPRMS 76 Query: 57 ISPRFLSPIGTPMKRVL 7 ++PRF++P+G+PM++ L Sbjct: 77 LTPRFITPLGSPMRKAL 93 >XP_018855333.1 PREDICTED: lysine histidine transporter-like 8 [Juglans regia] Length = 533 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 14/64 (21%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLL-------------KTPRTPWTPSL-ISPRFLSPIGTPM 19 TP + PPS SPS+ RSPLL KTP+TP TP L ++PRF++P+G+PM Sbjct: 28 TPPVSCPPSQFHSPSLSRSPLLHGEHAGAAGAPRNKTPKTPRTPRLSLTPRFITPLGSPM 87 Query: 18 KRVL 7 ++ L Sbjct: 88 RKAL 91 >XP_004512243.1 PREDICTED: lysine histidine transporter-like 8 [Cicer arietinum] Length = 534 Score = 54.3 bits (129), Expect = 2e-06 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 13/74 (17%) Frame = -2 Query: 189 GNSHSLSLSHQTPASTRPPSSLVSPSMPRSPLL------------KTPRTPWTPSL-ISP 49 GNS + +P + PPS L SPS+ RSPLL KTP+TP TP + ++P Sbjct: 17 GNSVMGTPIVSSPPISCPPSQLHSPSLTRSPLLQSENGDAPNPKNKTPKTPRTPRMSLTP 76 Query: 48 RFLSPIGTPMKRVL 7 RF++P+G+PM++ L Sbjct: 77 RFITPLGSPMRKAL 90 >XP_003612282.1 transmembrane amino acid transporter family protein [Medicago truncatula] AES95240.1 transmembrane amino acid transporter family protein [Medicago truncatula] Length = 534 Score = 54.3 bits (129), Expect = 2e-06 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 13/74 (17%) Frame = -2 Query: 189 GNSHSLSLSHQTPASTRPPSSLVSPSMPRSPLL------------KTPRTPWTPSL-ISP 49 GNS + +P + PPS L SPS+ RSPLL KTP+TP TP + ++P Sbjct: 17 GNSLMGTPRVASPPVSCPPSQLHSPSLTRSPLLQSENGDAPHPKSKTPKTPRTPRMSLTP 76 Query: 48 RFLSPIGTPMKRVL 7 RF++P+G+PM++ L Sbjct: 77 RFITPLGSPMRKAL 90 >KZM96239.1 hypothetical protein DCAR_019481 [Daucus carota subsp. sativus] Length = 493 Score = 53.1 bits (126), Expect = 4e-06 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLLKTPR-----TPWTP-SLISPRFLSPIGTPMKRVLSN 1 TP ++ P +++PS RSP + T + + WTP S ISPRFLSPIGTPMKRVL N Sbjct: 15 TPRASTP--EILTPSGQRSPRMGTSKEGKSSSAWTPTSFISPRFLSPIGTPMKRVLVN 70 >KFK29080.1 hypothetical protein AALP_AA7G086300 [Arabis alpina] Length = 518 Score = 53.1 bits (126), Expect = 4e-06 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSP--LLKTPRTPWTP-SLISPRFLSPIGTPMKRVLSN 1 TP ++ P +++PS RSP K+ WTP S ISPRFLSPIGTPMKRVL N Sbjct: 15 TPRASTP--EILTPSGQRSPRPATKSSSAAWTPTSFISPRFLSPIGTPMKRVLVN 67 >XP_003635214.1 PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera] Length = 526 Score = 53.1 bits (126), Expect = 4e-06 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 11/61 (18%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLL----------KTPRTPWTPSL-ISPRFLSPIGTPMKRV 10 TP + PPS SPS+ RSPLL KTP+ TP L ++PRF++P+G+PM+RV Sbjct: 22 TPPVSCPPSQFHSPSLTRSPLLHTDNEEAPQSKTPKASRTPRLSLTPRFITPLGSPMRRV 81 Query: 9 L 7 L Sbjct: 82 L 82 >XP_017254121.1 PREDICTED: lysine histidine transporter-like 8 [Daucus carota subsp. sativus] Length = 528 Score = 53.1 bits (126), Expect = 4e-06 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLLKTPR-----TPWTP-SLISPRFLSPIGTPMKRVLSN 1 TP ++ P +++PS RSP + T + + WTP S ISPRFLSPIGTPMKRVL N Sbjct: 21 TPRASTP--EILTPSGQRSPRMGTSKEGKSSSAWTPTSFISPRFLSPIGTPMKRVLVN 76 >CBI38472.3 unnamed protein product, partial [Vitis vinifera] Length = 759 Score = 53.1 bits (126), Expect = 4e-06 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 11/61 (18%) Frame = -2 Query: 156 TPASTRPPSSLVSPSMPRSPLL----------KTPRTPWTPSL-ISPRFLSPIGTPMKRV 10 TP + PPS SPS+ RSPLL KTP+ TP L ++PRF++P+G+PM+RV Sbjct: 255 TPPVSCPPSQFHSPSLTRSPLLHTDNEEAPQSKTPKASRTPRLSLTPRFITPLGSPMRRV 314 Query: 9 L 7 L Sbjct: 315 L 315