BLASTX nr result
ID: Ephedra29_contig00007592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00007592 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK25443.1 unknown [Picea sitchensis] 61 3e-09 AFG62202.1 hypothetical protein 2_7861_02, partial [Pinus taeda]... 54 2e-07 AEW08378.1 hypothetical protein 2_7861_02, partial [Pinus radiata] 54 2e-07 >ABK25443.1 unknown [Picea sitchensis] Length = 464 Score = 61.2 bits (147), Expect = 3e-09 Identities = 30/67 (44%), Positives = 42/67 (62%) Frame = -1 Query: 203 ISARKTHVALFTSLGLGHIIPASEFSRLLATEHNCKVTFITFPWEPKSRQDKILTALVSS 24 + ARK HVA+F S+G+GH+IP EF++LLA+ H +TFIT + Q +L SS Sbjct: 1 MDARKPHVAIFPSVGMGHLIPFFEFAKLLASGHGFSITFITAKFMVTPSQTAYTKSLASS 60 Query: 23 GLDIHLL 3 GL I + Sbjct: 61 GLSIRFI 67 >AFG62202.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62203.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62204.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62205.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62206.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62207.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62208.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62209.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62210.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62211.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62212.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62213.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62214.1 hypothetical protein 2_7861_02, partial [Pinus taeda] AFG62215.1 hypothetical protein 2_7861_02, partial [Pinus taeda] Length = 100 Score = 53.5 bits (127), Expect = 2e-07 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = -1 Query: 191 KTHVALFTSLGLGHIIPASEFSRLLATEHNCKVTFITFPWEPKSR-QDKILTALVSSGLD 15 K HVA+F G+GH+IP +E +R L+ H +T IT W R D ++ SSGLD Sbjct: 3 KPHVAIFPGAGMGHLIPVAELTRHLSATHGLSITLITCKWMFSPRLMDAYSKSMASSGLD 62 Query: 14 IHLL 3 I+ + Sbjct: 63 INFI 66 >AEW08378.1 hypothetical protein 2_7861_02, partial [Pinus radiata] Length = 100 Score = 53.5 bits (127), Expect = 2e-07 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = -1 Query: 191 KTHVALFTSLGLGHIIPASEFSRLLATEHNCKVTFITFPWEPKSR-QDKILTALVSSGLD 15 K HVA+F G+GH+IP +E +R L+ H +T IT W R D ++ SSGLD Sbjct: 3 KPHVAIFPGAGMGHLIPVAELTRHLSATHGLSITLITCKWMFSPRLMDAYSKSMASSGLD 62 Query: 14 IHLL 3 I+ + Sbjct: 63 INFI 66