BLASTX nr result
ID: Ephedra29_contig00007529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00007529 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG48855.1 hypothetical protein CL53Contig1_02, partial [Pinus t... 69 2e-13 ONK75003.1 uncharacterized protein A4U43_C03F12300 [Asparagus of... 73 1e-12 ACF83531.1 unknown [Zea mays] ACG44740.1 hypothetical protein [Z... 66 2e-12 KMZ67818.1 Elongation factor [Zostera marina] 72 5e-12 ONM11357.1 Elongation factor 2 [Zea mays] ONM11369.1 Elongation ... 69 1e-11 BAD93810.1 hypothetical protein, partial [Arabidopsis thaliana] 66 1e-11 ADE77394.1 unknown [Picea sitchensis] 69 1e-11 KMZ67821.1 Elongation factor [Zostera marina] 70 2e-11 BAO73917.1 elongation factor 2, partial [Echinochloa phyllopogon] 66 2e-11 NP_001140578.1 putative translation elongation factor family pro... 69 3e-11 ONM11355.1 Elongation factor 2 [Zea mays] ONM11365.1 Elongation ... 69 4e-11 BAA77028.1 elongation factor 2, partial [Lithospermum erythrorhi... 67 5e-11 AQL00681.1 Putative translation elongation factor family protein... 69 6e-11 ONK69796.1 uncharacterized protein A4U43_C05F26830 [Asparagus of... 69 6e-11 KXG37183.1 hypothetical protein SORBI_001G021300 [Sorghum bicolo... 69 6e-11 NP_001151465.1 uncharacterized protein LOC100285098 [Zea mays] X... 69 6e-11 XP_006647249.1 PREDICTED: elongation factor 2-like [Oryza brachy... 69 6e-11 XP_004969908.1 PREDICTED: elongation factor 2 [Setaria italica] ... 69 6e-11 XP_008654530.1 PREDICTED: uncharacterized protein LOC100272648 i... 69 6e-11 XP_002456335.1 hypothetical protein SORBIDRAFT_03g034200 [Sorghu... 69 6e-11 >AFG48855.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48856.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48857.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48858.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48859.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48860.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48861.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48862.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48863.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48864.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48865.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] AFG48866.1 hypothetical protein CL53Contig1_02, partial [Pinus taeda] Length = 41 Score = 68.9 bits (167), Expect = 2e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP+++ SQAG LV DIRKRKGLKE+MTPLSE+EDKL Sbjct: 1 DMMGSDPLESGSQAGQLVIDIRKRKGLKESMTPLSEYEDKL 41 >ONK75003.1 uncharacterized protein A4U43_C03F12300 [Asparagus officinalis] Length = 843 Score = 73.2 bits (178), Expect = 1e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDPMDATSQAG LV IRKRKGLKE MTPLS+FEDKL Sbjct: 803 DMMGSDPMDATSQAGQLVASIRKRKGLKEQMTPLSDFEDKL 843 >ACF83531.1 unknown [Zea mays] ACG44740.1 hypothetical protein [Zea mays] Length = 40 Score = 66.2 bits (160), Expect = 2e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +1 Query: 4 MMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 MMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 1 MMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 40 >KMZ67818.1 Elongation factor [Zostera marina] Length = 843 Score = 71.6 bits (174), Expect = 5e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMM SDP+D TSQ+ ILVKDIRKRKGLKE MTPLS+FEDKL Sbjct: 803 DMMSSDPLDPTSQSAILVKDIRKRKGLKEQMTPLSDFEDKL 843 >ONM11357.1 Elongation factor 2 [Zea mays] ONM11369.1 Elongation factor 2 [Zea mays] Length = 198 Score = 68.6 bits (166), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 158 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 198 >BAD93810.1 hypothetical protein, partial [Arabidopsis thaliana] Length = 111 Score = 66.2 bits (160), Expect = 1e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 +MM SDP++ +QA +LV DIRKRKGLKEAMTPLSEFEDKL Sbjct: 71 EMMSSDPLEPGTQASVLVADIRKRKGLKEAMTPLSEFEDKL 111 >ADE77394.1 unknown [Picea sitchensis] Length = 267 Score = 69.3 bits (168), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++ SQAG LV DIRKRKGLKE+MTPLS+FEDKL Sbjct: 227 DMMGSDPLETGSQAGQLVTDIRKRKGLKESMTPLSDFEDKL 267 >KMZ67821.1 Elongation factor [Zostera marina] Length = 843 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 D+M SDP+D TSQ+ ILVKDIRKRKGLKE MTPLS+FEDKL Sbjct: 803 DIMSSDPLDPTSQSAILVKDIRKRKGLKEQMTPLSDFEDKL 843 >BAO73917.1 elongation factor 2, partial [Echinochloa phyllopogon] Length = 129 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMM SDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 89 DMMSSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 129 >NP_001140578.1 putative translation elongation factor family protein [Zea mays] ACF84111.1 unknown [Zea mays] Length = 294 Score = 68.6 bits (166), Expect = 3e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 254 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 294 >ONM11355.1 Elongation factor 2 [Zea mays] ONM11365.1 Elongation factor 2 [Zea mays] AQL00680.1 Putative translation elongation factor family protein [Zea mays] Length = 338 Score = 68.6 bits (166), Expect = 4e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 298 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 338 >BAA77028.1 elongation factor 2, partial [Lithospermum erythrorhizon] Length = 222 Score = 67.0 bits (162), Expect = 5e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMM SDP+D T+QA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 182 DMMPSDPLDPTTQARTLVADIRKRKGLKEQMTPLSEFEDKL 222 >AQL00681.1 Putative translation elongation factor family protein [Zea mays] Length = 820 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 780 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 820 >ONK69796.1 uncharacterized protein A4U43_C05F26830 [Asparagus officinalis] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMM SDPMD+TSQAG LV IRKRKGLKE MTPLS++EDKL Sbjct: 803 DMMSSDPMDSTSQAGQLVASIRKRKGLKEQMTPLSDYEDKL 843 >KXG37183.1 hypothetical protein SORBI_001G021300 [Sorghum bicolor] KXG37184.1 hypothetical protein SORBI_001G021400 [Sorghum bicolor] KXG37185.1 hypothetical protein SORBI_001G021400 [Sorghum bicolor] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 843 >NP_001151465.1 uncharacterized protein LOC100285098 [Zea mays] XP_008665730.1 PREDICTED: elongation factor 2-like [Zea mays] ACG42954.1 elongation factor 2 [Zea mays] ONM11356.1 Elongation factor 2 [Zea mays] ONM11358.1 Elongation factor 2 [Zea mays] ONM11359.1 Elongation factor 2 [Zea mays] ONM11360.1 Elongation factor 2 [Zea mays] ONM11361.1 Elongation factor 2 [Zea mays] ONM11363.1 Elongation factor 2 [Zea mays] ONM11364.1 Elongation factor 2 [Zea mays] ONM11366.1 Elongation factor 2 [Zea mays] ONM11367.1 Elongation factor 2 [Zea mays] ONM11368.1 Elongation factor 2 [Zea mays] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 843 >XP_006647249.1 PREDICTED: elongation factor 2-like [Oryza brachyantha] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMM SDP+D TSQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMTSDPLDPTSQAATLVLDIRKRKGLKEQMTPLSEFEDKL 843 >XP_004969908.1 PREDICTED: elongation factor 2 [Setaria italica] XP_004969909.1 PREDICTED: elongation factor 2 [Setaria italica] XP_004987339.1 PREDICTED: elongation factor 2 [Setaria italica] XP_004987340.1 PREDICTED: elongation factor 2 [Setaria italica] KQK85671.1 hypothetical protein SETIT_020904mg [Setaria italica] KQK85672.1 hypothetical protein SETIT_020904mg [Setaria italica] KQL06922.1 hypothetical protein SETIT_000298mg [Setaria italica] KQL06923.1 hypothetical protein SETIT_000298mg [Setaria italica] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 843 >XP_008654530.1 PREDICTED: uncharacterized protein LOC100272648 isoform X1 [Zea mays] AQL00678.1 Putative translation elongation factor family protein [Zea mays] AQL00679.1 Putative translation elongation factor family protein [Zea mays] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 843 >XP_002456335.1 hypothetical protein SORBIDRAFT_03g034200 [Sorghum bicolor] EES01455.1 hypothetical protein SORBI_003G291500 [Sorghum bicolor] Length = 843 Score = 68.6 bits (166), Expect = 6e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +1 Query: 1 DMMGSDPMDATSQAGILVKDIRKRKGLKEAMTPLSEFEDKL 123 DMMGSDP++A SQA LV DIRKRKGLKE MTPLSEFEDKL Sbjct: 803 DMMGSDPLEAGSQAAQLVLDIRKRKGLKEQMTPLSEFEDKL 843