BLASTX nr result
ID: Ephedra29_contig00007265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00007265 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] 111 1e-29 OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] 111 3e-29 XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 111 4e-29 AIX10775.1 ubiquitin, partial [Panax notoginseng] 112 4e-29 OAY34514.1 hypothetical protein MANES_12G026400 [Manihot esculenta] 112 4e-29 XP_010248517.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 112 4e-29 XP_006846976.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 112 4e-29 KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scoly... 111 4e-29 AHA83529.1 ubiquitin extension protein [Hevea brasiliensis] OAY3... 112 6e-29 XP_003634320.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 112 8e-29 ADF36485.1 ubiquitin extension protein, partial [Ageratina adeno... 111 1e-28 XP_017426655.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 111 1e-28 XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 111 1e-28 XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medica... 111 1e-28 XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 111 1e-28 XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medica... 111 1e-28 XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 111 1e-28 CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] 111 1e-28 XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 111 1e-28 XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 111 1e-28 >OMO64086.1 Ribosomal protein S27a [Corchorus capsularis] Length = 81 Score = 111 bits (278), Expect = 1e-29 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 27 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 78 >OMO78278.1 Ribosomal protein S27a [Corchorus capsularis] Length = 113 Score = 111 bits (278), Expect = 3e-29 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 59 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 110 >XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial [Malus domestica] Length = 115 Score = 111 bits (278), Expect = 4e-29 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 61 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 112 >AIX10775.1 ubiquitin, partial [Panax notoginseng] Length = 155 Score = 112 bits (281), Expect = 4e-29 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKVEDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 101 VLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 152 >OAY34514.1 hypothetical protein MANES_12G026400 [Manihot esculenta] Length = 156 Score = 112 bits (281), Expect = 4e-29 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKVEDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVEDSGKVQRLRKECPNSECGAGTFMANHFDRHYCGKCGLTYVYNKA 153 >XP_010248517.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera] Length = 156 Score = 112 bits (281), Expect = 4e-29 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 +LQFYKV+DSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 LLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_006846976.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Amborella trichopoda] ERN08557.1 hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda] Length = 156 Score = 112 bits (281), Expect = 4e-29 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQ+LRKECPNQECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scolymus] Length = 123 Score = 111 bits (278), Expect = 4e-29 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 69 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 120 >AHA83529.1 ubiquitin extension protein [Hevea brasiliensis] OAY32566.1 hypothetical protein MANES_13G028100 [Manihot esculenta] Length = 156 Score = 112 bits (280), Expect = 6e-29 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKVEDSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA 153 >XP_003634320.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] XP_018854928.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] XP_018805239.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] XP_018815087.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Juglans regia] CAN75420.1 hypothetical protein VITISV_037877 [Vitis vinifera] Length = 156 Score = 112 bits (279), Expect = 8e-29 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNSECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >ADF36485.1 ubiquitin extension protein, partial [Ageratina adenophora] AID52926.1 ubiquitin [Carthamus tinctorius] Length = 153 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_017426655.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vigna angularis] BAT99518.1 hypothetical protein VIGAN_10096700 [Vigna angularis var. angularis] Length = 155 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna radiata var. radiata] XP_017418784.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] XP_017418785.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] Length = 155 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] ACJ83917.1 unknown [Medicago truncatula] ACJ86209.1 unknown [Medicago truncatula] AET04371.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] AES96161.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_016551560.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] XP_016551576.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Capsicum annuum] Length = 156 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >CAN80663.1 hypothetical protein VITISV_036195 [Vitis vinifera] Length = 156 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_002279878.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera] XP_012082969.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Jatropha curcas] CAN71283.1 hypothetical protein VITISV_027093 [Vitis vinifera] CAN70884.1 hypothetical protein VITISV_029192 [Vitis vinifera] KDP28317.1 hypothetical protein JCGZ_14088 [Jatropha curcas] Length = 156 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >XP_011040332.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus euphratica] Length = 156 Score = 111 bits (278), Expect = 1e-28 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -2 Query: 424 VLQFYKVEDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYPKA 269 VLQFYKV+DSGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA Sbjct: 102 VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153