BLASTX nr result
ID: Ephedra29_contig00006819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00006819 (748 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK27104.1 unknown [Picea sitchensis] 84 2e-16 XP_003633718.2 PREDICTED: uncharacterized protein LOC100243237 [... 70 5e-11 ERN04362.1 hypothetical protein AMTR_s00147p00067470 [Amborella ... 65 1e-09 AFG48702.1 hypothetical protein CL3131Contig1_04, partial [Pinus... 62 2e-09 AFG48690.1 hypothetical protein CL3131Contig1_04, partial [Pinus... 62 2e-09 AEW09007.1 hypothetical protein CL3131Contig1_04, partial [Pinus... 62 3e-09 XP_002966858.1 hypothetical protein SELMODRAFT_408071 [Selaginel... 64 3e-09 AFG43295.1 hypothetical protein 2_1093_01, partial [Pinus taeda] 63 5e-09 AFG43287.1 hypothetical protein 2_1093_01, partial [Pinus taeda]... 63 5e-09 AFG43286.1 hypothetical protein 2_1093_01, partial [Pinus taeda]... 63 5e-09 AEW08147.1 hypothetical protein 2_1093_01, partial [Pinus radiat... 63 5e-09 OIW02676.1 hypothetical protein TanjilG_29452 [Lupinus angustifo... 62 8e-09 AFG48701.1 hypothetical protein CL3131Contig1_04, partial [Pinus... 60 9e-09 OIW04454.1 hypothetical protein TanjilG_32646 [Lupinus angustifo... 62 1e-08 ERN04361.1 hypothetical protein AMTR_s00147p00064120 [Amborella ... 62 1e-08 XP_019460296.1 PREDICTED: uncharacterized protein LOC109360015 [... 62 2e-08 XP_002961151.1 hypothetical protein SELMODRAFT_402807 [Selaginel... 61 2e-08 XP_019455777.1 PREDICTED: uncharacterized protein LOC109356735 [... 62 3e-08 XP_011070844.1 PREDICTED: uncharacterized protein LOC105156423 [... 62 3e-08 XP_011078466.1 PREDICTED: uncharacterized protein LOC105162191 [... 61 3e-08 >ABK27104.1 unknown [Picea sitchensis] Length = 159 Score = 83.6 bits (205), Expect = 2e-16 Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 3/103 (2%) Frame = -2 Query: 552 CTFHTRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGLRKGRTESQEAIYDEGL---P 382 C H R + + +H + +KK L+ + R E +EA YD Sbjct: 44 CAAHFHRRNAKNRGTTGFKFAHKLPGRALINSSKKFLISKKWRRNEEEEAAYDRAAMEEQ 103 Query: 381 AGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 253 G +++W+R ILMGERC+PP FSG I+YDDKGNRLP FP +S Sbjct: 104 EGGGDSVWQRSILMGERCQPPAFSGLIIYDDKGNRLPQFPPRS 146 >XP_003633718.2 PREDICTED: uncharacterized protein LOC100243237 [Vitis vinifera] CBI33546.3 unnamed protein product, partial [Vitis vinifera] Length = 183 Score = 69.7 bits (169), Expect = 5e-11 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 7/106 (6%) Frame = -2 Query: 552 CTFH--TRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGL-----RKGRTESQEAIYD 394 C H T+ H+++E + G + +++N + KALL + RK + E +E Y+ Sbjct: 70 CASHRITKPHKLKEEGK--GAVKSKLVRSLNSNISSKALLMVKMVSWRKVQVEGEEGDYN 127 Query: 393 EGLPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVK 256 DDE +W+R I+MGERCRP +FSG I YD +GN LP+ P K Sbjct: 128 SD--GDDDEAVWKRTIMMGERCRPLDFSGKIAYDSQGNLLPNSPNK 171 >ERN04362.1 hypothetical protein AMTR_s00147p00067470 [Amborella trichopoda] Length = 126 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = -2 Query: 444 LLGLRKGRTESQEAIYDEGLPAGDDET---IWRRKILMGERCRPPNFSGAILYDDKGNRL 274 LL +KG E + I+ E + ET +W+RKILMGE+C PP+FSG I YD GN+L Sbjct: 39 LLTKKKGNEEIGDQIHHETETETETETEEGLWQRKILMGEKCEPPDFSGVIYYDHMGNQL 98 Query: 273 PHFPVKS 253 FP KS Sbjct: 99 SQFPPKS 105 >AFG48702.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 399 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 262 YD + G +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGDSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >AFG48690.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48691.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48692.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48693.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48694.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48695.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48696.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48697.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48698.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48699.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48700.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48703.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48704.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48706.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48707.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 399 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 262 YD + G +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGDSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >AEW09007.1 hypothetical protein CL3131Contig1_04, partial [Pinus radiata] Length = 68 Score = 61.6 bits (148), Expect = 3e-09 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 399 YDEG-LPAGDDETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 262 YD + G ++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 9 YDRAAMEEGGGNSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >XP_002966858.1 hypothetical protein SELMODRAFT_408071 [Selaginella moellendorffii] EFJ31457.1 hypothetical protein SELMODRAFT_408071 [Selaginella moellendorffii] Length = 136 Score = 63.5 bits (153), Expect = 3e-09 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -2 Query: 363 IWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 253 +W+R ILMGE+C PP+FSG ILYD++GNR+P +P KS Sbjct: 89 VWQRTILMGEKCEPPDFSGLILYDERGNRVPEYPAKS 125 >AFG43295.1 hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 4/75 (5%) Frame = -2 Query: 465 LTRAKKALLGLRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 298 ++ ++K L+ + G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 297 YDDKGNRLPHFPVKS 253 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >AFG43287.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43288.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43290.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43293.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43296.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43297.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43298.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43299.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43300.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43301.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43303.1 hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 4/75 (5%) Frame = -2 Query: 465 LTRAKKALLGLRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 298 ++ ++K L+ + G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 297 YDDKGNRLPHFPVKS 253 YDDKG +LP FP +S Sbjct: 120 YDDKGRQLPAFPPRS 134 >AFG43286.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43291.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43292.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43294.1 hypothetical protein 2_1093_01, partial [Pinus taeda] AFG43302.1 hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 4/75 (5%) Frame = -2 Query: 465 LTRAKKALLGLRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 298 ++ ++K L+ + G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 297 YDDKGNRLPHFPVKS 253 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >AEW08147.1 hypothetical protein 2_1093_01, partial [Pinus radiata] AFG43289.1 hypothetical protein 2_1093_01, partial [Pinus taeda] Length = 139 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 4/75 (5%) Frame = -2 Query: 465 LTRAKKALLGLRKGRTESQEAI--YDEGL--PAGDDETIWRRKILMGERCRPPNFSGAIL 298 ++ ++K L+ + G + ++ + YD + G +++W+R IL+GE+C P NFSG I+ Sbjct: 60 ISGSRKLLISKKWGISGEEDEVNAYDRAVMQEEGGGDSLWQRNILLGEKCEPLNFSGTII 119 Query: 297 YDDKGNRLPHFPVKS 253 YDDKG +LP FP +S Sbjct: 120 YDDKGKQLPAFPPRS 134 >OIW02676.1 hypothetical protein TanjilG_29452 [Lupinus angustifolius] Length = 102 Score = 61.6 bits (148), Expect = 8e-09 Identities = 31/86 (36%), Positives = 46/86 (53%) Frame = -2 Query: 528 EVQEVKRKAGRLSHVFKKAMNLTRAKKALLGLRKGRTESQEAIYDEGLPAGDDETIWRRK 349 E E ++ + K NL+ +++ + + E E + D+E +WR+ Sbjct: 10 ETVETPTRSNDSKFISKLNSNLSSRALSMVKMLSWKKEQVEGDGERDYGDKDEEVLWRKN 69 Query: 348 ILMGERCRPPNFSGAILYDDKGNRLP 271 ILMGERCRP +FSG ILYD +GN LP Sbjct: 70 ILMGERCRPIDFSGKILYDSEGNMLP 95 >AFG48701.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] AFG48705.1 hypothetical protein CL3131Contig1_04, partial [Pinus taeda] Length = 68 Score = 60.5 bits (145), Expect = 9e-09 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 369 ETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFP 262 +++W+R ILMGERC+PP+FSG ILYD KGNR+P P Sbjct: 20 DSVWQRGILMGERCQPPDFSGIILYDVKGNRVPQLP 55 >OIW04454.1 hypothetical protein TanjilG_32646 [Lupinus angustifolius] Length = 110 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -2 Query: 546 FHTRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGLRKGRTESQ--EAIYDEGLPAGD 373 + T E +++ +S + K + + LL RK + E++ E YD+ D Sbjct: 7 YQTETEESTTGSKESKLISKLHSKLSSRVLSMVKLLSWRKVQAETRYDEEDYDDE----D 62 Query: 372 DETIWRRKILMGERCRPPNFSGAILYDDKGNRL 274 ++ +WR+ ILMGERCRP +FSG ILYD KGN L Sbjct: 63 EQVLWRKNILMGERCRPIDFSGKILYDSKGNML 95 >ERN04361.1 hypothetical protein AMTR_s00147p00064120 [Amborella trichopoda] Length = 124 Score = 61.6 bits (148), Expect = 1e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 372 DETIWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 253 D +IW+++IL+G RC+P FSGAI+YD GNRLP FP KS Sbjct: 77 DSSIWKKRILIGNRCKPLEFSGAIIYDSDGNRLPKFPPKS 116 >XP_019460296.1 PREDICTED: uncharacterized protein LOC109360015 [Lupinus angustifolius] Length = 149 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/86 (36%), Positives = 46/86 (53%) Frame = -2 Query: 528 EVQEVKRKAGRLSHVFKKAMNLTRAKKALLGLRKGRTESQEAIYDEGLPAGDDETIWRRK 349 E E ++ + K NL+ +++ + + E E + D+E +WR+ Sbjct: 57 ETVETPTRSNDSKFISKLNSNLSSRALSMVKMLSWKKEQVEGDGERDYGDKDEEVLWRKN 116 Query: 348 ILMGERCRPPNFSGAILYDDKGNRLP 271 ILMGERCRP +FSG ILYD +GN LP Sbjct: 117 ILMGERCRPIDFSGKILYDSEGNMLP 142 >XP_002961151.1 hypothetical protein SELMODRAFT_402807 [Selaginella moellendorffii] EFJ38690.1 hypothetical protein SELMODRAFT_402807 [Selaginella moellendorffii] Length = 136 Score = 61.2 bits (147), Expect = 2e-08 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -2 Query: 363 IWRRKILMGERCRPPNFSGAILYDDKGNRLPHFPVKS 253 +W+R IL GE+C PP+FSG ILYD++GNR+P +P KS Sbjct: 89 VWQRTILTGEKCEPPDFSGLILYDERGNRVPEYPAKS 125 >XP_019455777.1 PREDICTED: uncharacterized protein LOC109356735 [Lupinus angustifolius] Length = 157 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -2 Query: 546 FHTRRHEVQEVKRKAGRLSHVFKKAMNLTRAKKALLGLRKGRTESQ--EAIYDEGLPAGD 373 + T E +++ +S + K + + LL RK + E++ E YD+ D Sbjct: 54 YQTETEESTTGSKESKLISKLHSKLSSRVLSMVKLLSWRKVQAETRYDEEDYDDE----D 109 Query: 372 DETIWRRKILMGERCRPPNFSGAILYDDKGNRL 274 ++ +WR+ ILMGERCRP +FSG ILYD KGN L Sbjct: 110 EQVLWRKNILMGERCRPIDFSGKILYDSKGNML 142 >XP_011070844.1 PREDICTED: uncharacterized protein LOC105156423 [Sesamum indicum] Length = 159 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/78 (41%), Positives = 43/78 (55%) Frame = -2 Query: 480 KKAMNLTRAKKALLGLRKGRTESQEAIYDEGLPAGDDETIWRRKILMGERCRPPNFSGAI 301 K + L AKK+LL T++QE + +W++ ILMGE+C+PP FSG I Sbjct: 71 KAMIPLVHAKKSLLHPGNNNTKAQEEM-----------GLWQKAILMGEKCQPPEFSGVI 119 Query: 300 LYDDKGNRLPHFPVKSRA 247 YD GNR+P P RA Sbjct: 120 YYDYSGNRIPEMPKSPRA 137 >XP_011078466.1 PREDICTED: uncharacterized protein LOC105162191 [Sesamum indicum] Length = 148 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -2 Query: 477 KAMNLTRAKKALLGLRKGRTESQEAIYDEGLPAGDDET-IWRRKILMGERCRPPNFSGAI 301 K + T + KA++ ++K + G+ D E+ +W++ ILMGERC+PP FSG I Sbjct: 66 KQLITTLSNKAMIHVKKSS--------ESGVGRNDQESGLWQKAILMGERCQPPEFSGVI 117 Query: 300 LYDDKGNRLPHFPVKSRA 247 YD GNR+P P RA Sbjct: 118 YYDYSGNRIPEMPKSPRA 135