BLASTX nr result
ID: Ephedra29_contig00006607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00006607 (622 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN62594.1 hypothetical protein VITISV_023518 [Vitis vinifera] 62 1e-08 XP_002278088.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 ... 62 1e-07 ABK24858.1 unknown [Picea sitchensis] 59 9e-07 XP_010045161.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 ... 58 2e-06 XP_016188472.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-... 57 3e-06 XP_010247897.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-... 57 5e-06 XP_015953235.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 ... 56 7e-06 CDP21347.1 unnamed protein product [Coffea canephora] 56 9e-06 XP_018851842.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-... 56 9e-06 >CAN62594.1 hypothetical protein VITISV_023518 [Vitis vinifera] Length = 153 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DPLK S IAN P+FEAH VE PPWS V +D NLLQKA+ K L + Sbjct: 20 IDPLKHSSIANFPEFEAHLVEMPPWSEVPAAKDDRNLLQKAEIKFLNQV 68 >XP_002278088.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 [Vitis vinifera] Length = 391 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DPLK S IAN P+FEAH VE PPWS V +D NLLQKA+ K L + Sbjct: 20 IDPLKHSSIANFPEFEAHLVEMPPWSEVPAAKDDRNLLQKAEIKFLNQV 68 >ABK24858.1 unknown [Picea sitchensis] Length = 423 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTI-PRDYENLLQKADTKTLGGI 620 +DP SPIA+ PDF+AH +E PPW+ +I P D N LQKAD K+L G+ Sbjct: 51 LDPFHHSPIADFPDFKAHTIECPPWAEFSIFPTDSNNRLQKADLKSLNGV 100 >XP_010045161.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 [Eucalyptus grandis] KCW87315.1 hypothetical protein EUGRSUZ_B03802 [Eucalyptus grandis] Length = 391 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DPL S +AN PDFEA+ V+ PPWS V RD ENLLQ+++ K L I Sbjct: 20 LDPLGRSAVANFPDFEAYKVDMPPWSDVPTERDAENLLQRSEIKFLNQI 68 >XP_016188472.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-like [Arachis ipaensis] XP_016188473.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-like [Arachis ipaensis] Length = 393 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DP + SPIA+ P+FEA +E PPWS V +D ENLLQK++ K L + Sbjct: 20 LDPFRHSPIASFPEFEAKLIEMPPWSEVPPEKDSENLLQKSEVKFLNEV 68 >XP_010247897.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-like [Nelumbo nucifera] Length = 391 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DP K S I++ PDF AH ++ PPWS + + RD +NLLQKA+ K L + Sbjct: 20 IDPFKHSAISSFPDFVAHKIDLPPWSEIPVERDTQNLLQKAEIKFLNQV 68 >XP_015953235.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3 [Arachis duranensis] Length = 393 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DP + SPIA+ P+FEA ++ PPWS V +D ENLLQK++ K L + Sbjct: 20 LDPFRHSPIASFPEFEAKLIQMPPWSEVPPEKDSENLLQKSEVKFLNEV 68 >CDP21347.1 unnamed protein product [Coffea canephora] Length = 391 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +3 Query: 474 MDPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 +DPLK S I N PDF AH VE P WS + + +D +NLLQK++ K L I Sbjct: 20 LDPLKHSAIYNFPDFVAHKVEMPAWSEIPVEKDAQNLLQKSEIKFLNQI 68 >XP_018851842.1 PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 3-like [Juglans regia] Length = 392 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +3 Query: 477 DPLKLSPIANHPDFEAHFVETPPWSSVTIPRDYENLLQKADTKTLGGI 620 DP K S I+ PDFEA+ VE PPWS V RD +NLLQK++ K L + Sbjct: 22 DPFKHSAISQFPDFEAYAVEMPPWSQVPTERDTQNLLQKSEIKFLNQV 69