BLASTX nr result
ID: Ephedra29_contig00006099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00006099 (674 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OLE32470.1 DUF1674 domain-containing protein [Alphaproteobacteri... 59 1e-08 EKN00464.1 hypothetical protein MXAZACID_05286 [Acidocella sp. M... 58 4e-08 OAI06797.1 hypothetical protein A1332_10470 [Methylomonas methan... 58 4e-08 OAI05686.1 hypothetical protein A1353_10980 [Methylomonas methan... 57 8e-08 WP_076454336.1 DUF1674 domain-containing protein [Acidiphilium r... 57 1e-07 WP_073211173.1 DUF1674 domain-containing protein [Acidocella ami... 57 1e-07 CDI01872.1 conserved hypothetical protein [Candidatus Competibac... 57 1e-07 XP_017440137.1 PREDICTED: succinate dehydrogenase assembly facto... 58 2e-07 GAN74028.1 hypothetical protein Apmu_0131_25 [Acidiphilium multi... 56 2e-07 ABQ32048.1 protein of unknown function DUF1674 [Acidiphilium cry... 56 2e-07 WP_011629075.1 DUF1674 domain-containing protein [Alkalilimnicol... 56 2e-07 WP_036275648.1 DUF1674 domain-containing protein [Methylomonas s... 56 2e-07 WP_033157414.1 DUF1674 domain-containing protein [Methylomonas s... 56 2e-07 SDH10666.1 Protein of unknown function [Roseospirillum parvum] 55 6e-07 CCG07752.1 Putative uncharacterized protein [Pararhodospirillum ... 55 7e-07 CCQ72173.1 conserved protein of unknown function (DUF1674) [Magn... 55 7e-07 WP_046020050.1 DUF1674 domain-containing protein [Magnetospira s... 55 8e-07 WP_071414586.1 hypothetical protein [Acinetobacter baumannii] OI... 55 8e-07 WP_020482374.1 DUF1674 domain-containing protein [Methylomonas s... 55 8e-07 WP_075768542.1 DUF1674 domain-containing protein [Rhodocista sp.... 54 1e-06 >OLE32470.1 DUF1674 domain-containing protein [Alphaproteobacteria bacterium 13_1_20CM_3_64_12] Length = 53 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P PREIGGPKGPEPTRYGDWE GGRC Sbjct: 24 PPQPREIGGPKGPEPTRYGDWEIGGRC 50 >EKN00464.1 hypothetical protein MXAZACID_05286 [Acidocella sp. MX-AZ02] Length = 48 Score = 57.8 bits (138), Expect = 4e-08 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P +P+EIGGP GPEPTRYGDWEK GRC Sbjct: 19 PKLPKEIGGPTGPEPTRYGDWEKNGRC 45 >OAI06797.1 hypothetical protein A1332_10470 [Methylomonas methanica] Length = 63 Score = 58.2 bits (139), Expect = 4e-08 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 337 NPAVPREIGGPKGPEPTRYGDWEKGGRC 420 NPA+P EI GPKGPEPTR+GDWE+ GRC Sbjct: 33 NPAIPTEINGPKGPEPTRFGDWERKGRC 60 >OAI05686.1 hypothetical protein A1353_10980 [Methylomonas methanica] Length = 63 Score = 57.4 bits (137), Expect = 8e-08 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 337 NPAVPREIGGPKGPEPTRYGDWEKGGRC 420 NPA+P EI GPKGPEPTR+GDWE+ GRC Sbjct: 33 NPALPTEINGPKGPEPTRFGDWERKGRC 60 >WP_076454336.1 DUF1674 domain-containing protein [Acidiphilium rubrum] SIQ20824.1 Protein of unknown function [Acidiphilium rubrum] Length = 44 Score = 56.6 bits (135), Expect = 1e-07 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +1 Query: 346 VPREIGGPKGPEPTRYGDWEKGGRC 420 +P+EIGGPKGPEPTRYGDWE+ GRC Sbjct: 17 MPKEIGGPKGPEPTRYGDWERNGRC 41 >WP_073211173.1 DUF1674 domain-containing protein [Acidocella aminolytica] GAN78674.1 hypothetical protein Aam_005_073 [Acidocella aminolytica 101 = DSM 11237] SHE45021.1 Protein of unknown function [Acidocella aminolytica 101 = DSM 11237] Length = 50 Score = 56.6 bits (135), Expect = 1e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P P+EIGGP GPEPTRYGDWEK GRC Sbjct: 21 PKQPKEIGGPAGPEPTRYGDWEKNGRC 47 >CDI01872.1 conserved hypothetical protein [Candidatus Competibacter denitrificans Run_A_D11] Length = 56 Score = 56.6 bits (135), Expect = 1e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P P+E GGPKGPEPTRYGDWEK GRC Sbjct: 27 PDKPKEYGGPKGPEPTRYGDWEKAGRC 53 >XP_017440137.1 PREDICTED: succinate dehydrogenase assembly factor 4, mitochondrial isoform X1 [Vigna angularis] XP_017440138.1 PREDICTED: succinate dehydrogenase assembly factor 4, mitochondrial isoform X1 [Vigna angularis] XP_017440139.1 PREDICTED: succinate dehydrogenase assembly factor 4, mitochondrial isoform X1 [Vigna angularis] XP_017440140.1 PREDICTED: succinate dehydrogenase assembly factor 4, mitochondrial isoform X1 [Vigna angularis] Length = 126 Score = 58.2 bits (139), Expect = 2e-07 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 9/126 (7%) Frame = +1 Query: 70 VLNINQERKSCNKLLLASTME---------LLHFARRLKLHGKSSLSILHINRLAYVRGS 222 ++N++Q R++C + +AS+ LH R +L+G S S+ RL + Sbjct: 1 MINLSQTRRNCEQATMASSFPRSLTSIANTALHHTRSEQLNGIVSNSV---TRLLCTSST 57 Query: 223 NFFCSSVADKQSIKDKETDXXXXXXXXXXXXXXXXXXANPAVPREIGGPKGPEPTRYGDW 402 + KQ+ +E+ + EIGGPKGPEPTRYGDW Sbjct: 58 QLQQENPVKKQAQSPQESLHDEIKQIHEQEEDNEDGDSINKETGEIGGPKGPEPTRYGDW 117 Query: 403 EKGGRC 420 E+ GRC Sbjct: 118 ERNGRC 123 >GAN74028.1 hypothetical protein Apmu_0131_25 [Acidiphilium multivorum AIU301] Length = 58 Score = 56.2 bits (134), Expect = 2e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 349 PREIGGPKGPEPTRYGDWEKGGRC 420 P+EIGGPKGPEPTRYGDWE+ GRC Sbjct: 32 PKEIGGPKGPEPTRYGDWERNGRC 55 >ABQ32048.1 protein of unknown function DUF1674 [Acidiphilium cryptum JF-5] KDM68081.1 hypothetical protein DUF1674 [Acidiphilium sp. JA12-A1] Length = 58 Score = 56.2 bits (134), Expect = 2e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 349 PREIGGPKGPEPTRYGDWEKGGRC 420 P+EIGGPKGPEPTRYGDWE+ GRC Sbjct: 32 PKEIGGPKGPEPTRYGDWERNGRC 55 >WP_011629075.1 DUF1674 domain-containing protein [Alkalilimnicola ehrlichii] ABI56680.1 protein of unknown function DUF1674 [Alkalilimnicola ehrlichii MLHE-1] Length = 59 Score = 56.2 bits (134), Expect = 2e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 349 PREIGGPKGPEPTRYGDWEKGGRC 420 P+EIGGPKGPEPTRYGDWE+ GRC Sbjct: 33 PKEIGGPKGPEPTRYGDWERNGRC 56 >WP_036275648.1 DUF1674 domain-containing protein [Methylomonas sp. 11b] Length = 63 Score = 56.2 bits (134), Expect = 2e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 337 NPAVPREIGGPKGPEPTRYGDWEKGGRC 420 +PA+P EI GPKGPEPTR+GDWE+ GRC Sbjct: 33 DPAIPTEINGPKGPEPTRFGDWERKGRC 60 >WP_033157414.1 DUF1674 domain-containing protein [Methylomonas sp. LW13] Length = 63 Score = 56.2 bits (134), Expect = 2e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 337 NPAVPREIGGPKGPEPTRYGDWEKGGRC 420 +PA+P EI GPKGPEPTR+GDWE+ GRC Sbjct: 33 DPAIPTEINGPKGPEPTRFGDWERKGRC 60 >SDH10666.1 Protein of unknown function [Roseospirillum parvum] Length = 62 Score = 55.1 bits (131), Expect = 6e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P REIGGPKGPEPTRYGDWE+ GRC Sbjct: 33 PPAGREIGGPKGPEPTRYGDWEQKGRC 59 >CCG07752.1 Putative uncharacterized protein [Pararhodospirillum photometricum DSM 122] Length = 55 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 PA P EIGGP+GPEPTRY DWE+ GRC Sbjct: 26 PAPPPEIGGPRGPEPTRYNDWERNGRC 52 >CCQ72173.1 conserved protein of unknown function (DUF1674) [Magnetospira sp. QH-2] Length = 84 Score = 55.5 bits (132), Expect = 7e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P+ P E GGPKGPEPTRYGDWEK GRC Sbjct: 55 PSDPNESGGPKGPEPTRYGDWEKKGRC 81 >WP_046020050.1 DUF1674 domain-containing protein [Magnetospira sp. QH-2] Length = 86 Score = 55.5 bits (132), Expect = 8e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 340 PAVPREIGGPKGPEPTRYGDWEKGGRC 420 P+ P E GGPKGPEPTRYGDWEK GRC Sbjct: 57 PSDPNESGGPKGPEPTRYGDWEKKGRC 83 >WP_071414586.1 hypothetical protein [Acinetobacter baumannii] OIC48849.1 hypothetical protein A7L55_20310 [Acinetobacter baumannii] Length = 73 Score = 55.1 bits (131), Expect = 8e-07 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +1 Query: 226 FFCSSV---ADKQSIKDKETDXXXXXXXXXXXXXXXXXXANPAVPREIGGPKGPEPTRYG 396 +FCSSV + +K+++ NP E GGP+GPEPTRYG Sbjct: 4 YFCSSVQYPVNSNELKNEDEQEEEPHGNHSEEEEEGGEHVNPETG-ERGGPRGPEPTRYG 62 Query: 397 DWEKGGRC 420 DWEKGGRC Sbjct: 63 DWEKGGRC 70 >WP_020482374.1 DUF1674 domain-containing protein [Methylomonas sp. MK1] Length = 63 Score = 54.7 bits (130), Expect = 8e-07 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 337 NPAVPREIGGPKGPEPTRYGDWEKGGRC 420 +P +P EI GPKGPEPTR+GDWE+ GRC Sbjct: 33 DPTIPTEINGPKGPEPTRFGDWERKGRC 60 >WP_075768542.1 DUF1674 domain-containing protein [Rhodocista sp. MIMtkB3] Length = 55 Score = 54.3 bits (129), Expect = 1e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 349 PREIGGPKGPEPTRYGDWEKGGRC 420 P EIGGP GPEPTRYGDWE+GGRC Sbjct: 29 PGEIGGPAGPEPTRYGDWEQGGRC 52