BLASTX nr result
ID: Ephedra29_contig00006090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00006090 (764 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK22291.1 unknown [Picea sitchensis] 55 6e-07 XP_002315204.1 eukaryotic translation initiation factor 3G famil... 53 4e-06 XP_006488394.1 PREDICTED: eukaryotic translation initiation fact... 53 4e-06 XP_006424916.1 hypothetical protein CICLE_v10028957mg [Citrus cl... 53 4e-06 GAV70317.1 RRM_1 domain-containing protein/eIF3g domain-containi... 52 1e-05 >ABK22291.1 unknown [Picea sitchensis] Length = 306 Score = 55.1 bits (131), Expect(2) = 6e-07 Identities = 24/43 (55%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 728 DGEGGHQIR--ELDDEDNDDLGFLLPPPQVLGPDASGVKKVID 606 D + ++R EL++EDN+DL FLLPPP+V+GPD +GVKK+I+ Sbjct: 6 DSKASAKVRWGELEEEDNEDLDFLLPPPKVVGPDENGVKKIIE 48 Score = 26.9 bits (58), Expect(2) = 6e-07 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 544 KRALEHRHWKKFG 506 KRALE R W+KFG Sbjct: 76 KRALERREWRKFG 88 >XP_002315204.1 eukaryotic translation initiation factor 3G family protein [Populus trichocarpa] EEF01375.1 eukaryotic translation initiation factor 3G family protein [Populus trichocarpa] Length = 294 Score = 52.8 bits (125), Expect(2) = 4e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 701 ELDDEDNDDLGFLLPPPQVLGPDASGVKKVID 606 ELD+ED +DL FLLPP QV+GPD +G+KKVI+ Sbjct: 17 ELDEEDGEDLDFLLPPKQVIGPDENGIKKVIE 48 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 544 KRALEHRHWKKFG 506 KRALE R+W KFG Sbjct: 76 KRALERRNWSKFG 88 >XP_006488394.1 PREDICTED: eukaryotic translation initiation factor 3 subunit G [Citrus sinensis] KDO66649.1 hypothetical protein CISIN_1g022742mg [Citrus sinensis] Length = 293 Score = 53.1 bits (126), Expect(2) = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 701 ELDDEDNDDLGFLLPPPQVLGPDASGVKKVID 606 ELD+ED +DL FLLPP QV+GPD +GVKKVI+ Sbjct: 17 ELDEEDGEDLDFLLPPKQVIGPDENGVKKVIE 48 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 544 KRALEHRHWKKFG 506 KRALE R+W KFG Sbjct: 76 KRALERRNWAKFG 88 >XP_006424916.1 hypothetical protein CICLE_v10028957mg [Citrus clementina] ESR38156.1 hypothetical protein CICLE_v10028957mg [Citrus clementina] Length = 293 Score = 53.1 bits (126), Expect(2) = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 701 ELDDEDNDDLGFLLPPPQVLGPDASGVKKVID 606 ELD+ED +DL FLLPP QV+GPD +GVKKVI+ Sbjct: 17 ELDEEDGEDLDFLLPPKQVIGPDENGVKKVIE 48 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 544 KRALEHRHWKKFG 506 KRALE R+W KFG Sbjct: 76 KRALERRNWAKFG 88 >GAV70317.1 RRM_1 domain-containing protein/eIF3g domain-containing protein [Cephalotus follicularis] Length = 296 Score = 51.6 bits (122), Expect(2) = 1e-05 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 701 ELDDEDNDDLGFLLPPPQVLGPDASGVKKVID 606 ELD+ED +DL FLLPP QV GPD +G+KKVI+ Sbjct: 19 ELDEEDGEDLDFLLPPKQVTGPDENGIKKVIE 50 Score = 26.2 bits (56), Expect(2) = 1e-05 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 544 KRALEHRHWKKFG 506 KRALE R+W KFG Sbjct: 78 KRALERRNWPKFG 90