BLASTX nr result
ID: Ephedra29_contig00005934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00005934 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012831808.1 PREDICTED: peroxidase 21 [Erythranthe guttata] EY... 55 5e-06 CAA65637.1 basic peroxidase homologue, partial [Allium cepa] 50 6e-06 >XP_012831808.1 PREDICTED: peroxidase 21 [Erythranthe guttata] EYU41619.1 hypothetical protein MIMGU_mgv1a010067mg [Erythranthe guttata] Length = 323 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 454 NDYFFAQFSRALIILSEHNPLSSSQGDVRKTCKSLN 347 N YF QFSRAL+ILSE+NPLS QGD+RK C+ LN Sbjct: 287 NAYFHDQFSRALLILSENNPLSGDQGDIRKDCRFLN 322 >CAA65637.1 basic peroxidase homologue, partial [Allium cepa] Length = 41 Score = 50.4 bits (119), Expect = 6e-06 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = -3 Query: 451 DYFFAQFSRALIILSEHNPLSSSQGDVRKTCKSLN 347 DYFF +FSRA+ +LSE+NPL+ +QG+VRK C N Sbjct: 4 DYFFKEFSRAITLLSENNPLTGTQGEVRKQCNVAN 38