BLASTX nr result
ID: Ephedra29_contig00005600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00005600 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002466630.1 hypothetical protein SORBIDRAFT_01g011310 [Sorghu... 58 3e-08 EAY97444.1 hypothetical protein OsI_19374 [Oryza sativa Indica G... 58 3e-08 ONM07983.1 Heat shock 70 kDa protein 6 chloroplastic [Zea mays] 58 3e-08 ABP65327.1 chloroplast heat shock protein 70 [Cenchrus americanus] 58 3e-08 XP_004962155.1 PREDICTED: stromal 70 kDa heat shock-related prot... 58 3e-08 KXG37805.1 hypothetical protein SORBI_001G129000 [Sorghum bicolor] 58 3e-08 XP_020201388.1 heat shock 70 kDa protein 6, chloroplastic-like [... 58 3e-08 ONM07984.1 Heat shock 70 kDa protein 6 chloroplastic [Zea mays] 58 3e-08 XP_008644594.1 PREDICTED: stromal 70 kDa heat shock-related prot... 58 3e-08 XP_003568673.1 PREDICTED: stromal 70 kDa heat shock-related prot... 58 3e-08 XP_015639965.1 PREDICTED: stromal 70 kDa heat shock-related prot... 58 3e-08 XP_002974918.1 hypothetical protein SELMODRAFT_267815 [Selaginel... 57 1e-07 OIW13599.1 hypothetical protein TanjilG_07941 [Lupinus angustifo... 57 1e-07 XP_002988934.1 hypothetical protein SELMODRAFT_235653 [Selaginel... 57 1e-07 XP_019440402.1 PREDICTED: stromal 70 kDa heat shock-related prot... 57 1e-07 XP_019703365.1 PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa... 57 1e-07 XP_010930060.1 PREDICTED: stromal 70 kDa heat shock-related prot... 57 1e-07 KFK33012.1 hypothetical protein AALP_AA6G318800 [Arabis alpina] 57 1e-07 XP_008792217.1 PREDICTED: LOW QUALITY PROTEIN: stromal 70 kDa he... 57 1e-07 KRH26302.1 hypothetical protein GLYMA_12G1662002, partial [Glyci... 56 1e-07 >XP_002466630.1 hypothetical protein SORBIDRAFT_01g011310 [Sorghum bicolor] Length = 487 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 68 >EAY97444.1 hypothetical protein OsI_19374 [Oryza sativa Indica Group] Length = 648 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 42 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 71 >ONM07983.1 Heat shock 70 kDa protein 6 chloroplastic [Zea mays] Length = 651 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 37 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 66 >ABP65327.1 chloroplast heat shock protein 70 [Cenchrus americanus] Length = 679 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 37 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 66 >XP_004962155.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Setaria italica] KQL15588.1 hypothetical protein SETIT_021389mg [Setaria italica] Length = 680 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 37 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 66 >KXG37805.1 hypothetical protein SORBI_001G129000 [Sorghum bicolor] Length = 682 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 68 >XP_020201388.1 heat shock 70 kDa protein 6, chloroplastic-like [Aegilops tauschii subsp. tauschii] EMT14862.1 Stromal 70 kDa heat shock-related protein, chloroplastic [Aegilops tauschii] Length = 682 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 68 >ONM07984.1 Heat shock 70 kDa protein 6 chloroplastic [Zea mays] Length = 683 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 37 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 66 >XP_008644594.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Zea mays] AQK63737.1 Heat shock 70 kDa protein 6 chloroplastic [Zea mays] Length = 683 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 37 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 66 >XP_003568673.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Brachypodium distachyon] KQK06850.1 hypothetical protein BRADI_2g30560 [Brachypodium distachyon] Length = 684 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 68 >XP_015639965.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Oryza sativa Japonica Group] EEE63158.1 hypothetical protein OsJ_17967 [Oryza sativa Japonica Group] Length = 689 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 W+PLRV EKVVGIDLGTTNSAVAAMEGGK Sbjct: 42 WRPLRVACEKVVGIDLGTTNSAVAAMEGGK 71 >XP_002974918.1 hypothetical protein SELMODRAFT_267815 [Selaginella moellendorffii] EFJ23703.1 hypothetical protein SELMODRAFT_267815 [Selaginella moellendorffii] Length = 660 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 PLRVVSEKVVGIDLGTTNSAVAAMEGGK Sbjct: 14 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 41 >OIW13599.1 hypothetical protein TanjilG_07941 [Lupinus angustifolius] Length = 662 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 ++PLRVV+EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 FRPLRVVNEKVVGIDLGTTNSAVAAMEGGK 68 >XP_002988934.1 hypothetical protein SELMODRAFT_235653 [Selaginella moellendorffii] EFJ09963.1 hypothetical protein SELMODRAFT_235653 [Selaginella moellendorffii] Length = 663 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 PLRVVSEKVVGIDLGTTNSAVAAMEGGK Sbjct: 17 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 44 >XP_019440402.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Lupinus angustifolius] Length = 685 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 ++PLRVV+EKVVGIDLGTTNSAVAAMEGGK Sbjct: 39 FRPLRVVNEKVVGIDLGTTNSAVAAMEGGK 68 >XP_019703365.1 PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 6, chloroplastic-like [Elaeis guineensis] Length = 698 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 PLRVVSEKVVGIDLGTTNSAVAAMEGGK Sbjct: 63 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 90 >XP_010930060.1 PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic [Elaeis guineensis] Length = 707 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 PLRVVSEKVVGIDLGTTNSAVAAMEGGK Sbjct: 64 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 91 >KFK33012.1 hypothetical protein AALP_AA6G318800 [Arabis alpina] Length = 709 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 90 WKPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 ++PLRVV+EKVVGIDLGTTNSAVAAMEGGK Sbjct: 64 FRPLRVVNEKVVGIDLGTTNSAVAAMEGGK 93 >XP_008792217.1 PREDICTED: LOW QUALITY PROTEIN: stromal 70 kDa heat shock-related protein, chloroplastic-like [Phoenix dactylifera] Length = 718 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 84 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 PLRVVSEKVVGIDLGTTNSAVAAMEGGK Sbjct: 64 PLRVVSEKVVGIDLGTTNSAVAAMEGGK 91 >KRH26302.1 hypothetical protein GLYMA_12G1662002, partial [Glycine max] Length = 276 Score = 56.2 bits (134), Expect = 1e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 87 KPLRVVSEKVVGIDLGTTNSAVAAMEGGK 1 +PLRVV+EKVVGIDLGTTNSAVAAMEGGK Sbjct: 42 RPLRVVNEKVVGIDLGTTNSAVAAMEGGK 70