BLASTX nr result
ID: Ephedra29_contig00005351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00005351 (1271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG59021.1 hypothetical protein CL770Contig1_07, partial [Pinus ... 55 1e-06 ADE76565.1 unknown [Picea sitchensis] 59 4e-06 WP_071414456.1 hypothetical protein [Acinetobacter baumannii] OI... 56 6e-06 >AFG59021.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59022.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59023.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59024.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59025.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59026.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59027.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59028.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59029.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59030.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59031.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59032.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] AFG59033.1 hypothetical protein CL770Contig1_07, partial [Pinus taeda] Length = 38 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 537 GSVLVGEISLMSAFATGQLVKSHMKYN*SNKDLKA 433 G+VL GE+SLMSA A GQLVKSHMKYN S KD+KA Sbjct: 2 GAVLAGELSLMSALAAGQLVKSHMKYNRSIKDIKA 36 >ADE76565.1 unknown [Picea sitchensis] Length = 305 Score = 59.3 bits (142), Expect = 4e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 537 GSVLVGEISLMSAFATGQLVKSHMKYN*SNKDLKASN 427 G+VL GE+SLMSA A GQLVKSHMKYN SNKD+KA++ Sbjct: 269 GAVLAGELSLMSALAAGQLVKSHMKYNRSNKDMKANS 305 >WP_071414456.1 hypothetical protein [Acinetobacter baumannii] OIC67650.1 hypothetical protein A7L55_18370 [Acinetobacter baumannii] Length = 134 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 537 GSVLVGEISLMSAFATGQLVKSHMKYN*SNKDLKAS 430 G+VL GE+SLMSA A GQLV SHMKYN SNKD KA+ Sbjct: 98 GAVLAGELSLMSALAAGQLVNSHMKYNRSNKDTKAT 133