BLASTX nr result
ID: Ephedra29_contig00004753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00004753 (480 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEW09046.1 hypothetical protein CL3398Contig1_03, partial [Pinus... 55 1e-07 AEW09045.1 hypothetical protein CL3398Contig1_03, partial [Pinus... 55 1e-07 >AEW09046.1 hypothetical protein CL3398Contig1_03, partial [Pinus lambertiana] Length = 39 Score = 55.1 bits (131), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 467 KRSECERQALNFAKKIMKERREFKSIYQVVQLVEG 363 KRSECER+ALNFAK +MKERR F +I QVVQ V+G Sbjct: 3 KRSECERRALNFAKMLMKERRNFHTISQVVQAVQG 37 >AEW09045.1 hypothetical protein CL3398Contig1_03, partial [Pinus radiata] AFG53768.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53769.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53770.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53771.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53772.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53773.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53774.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53775.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53776.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53777.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53778.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53779.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53780.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53781.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53782.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] AFG53783.1 hypothetical protein CL3398Contig1_03, partial [Pinus taeda] Length = 39 Score = 55.1 bits (131), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 467 KRSECERQALNFAKKIMKERREFKSIYQVVQLVEG 363 KRSECER+ALNFAK +MKERR F +I QVVQ V+G Sbjct: 3 KRSECERRALNFAKMLMKERRNFHTISQVVQAVQG 37