BLASTX nr result
ID: Ephedra29_contig00004694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00004694 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG63904.1 hypothetical protein CL2213Contig1_03, partial [Pinus... 73 4e-15 AEW08907.1 hypothetical protein CL2213Contig1_03, partial [Pinus... 73 4e-15 CDP10173.1 unnamed protein product [Coffea canephora] 75 6e-15 XP_017253395.1 PREDICTED: dirigent protein 22-like [Daucus carot... 76 6e-15 XP_006373795.1 hypothetical protein POPTR_0016s06080g, partial [... 73 1e-14 XP_007029061.1 PREDICTED: dirigent protein 22 [Theobroma cacao] ... 75 2e-14 AEX11972.1 hypothetical protein 0_18318_01, partial [Pinus taeda... 73 3e-14 KJB46354.1 hypothetical protein B456_007G362500 [Gossypium raimo... 74 3e-14 KDO70858.1 hypothetical protein CISIN_1g043227mg [Citrus sinensis] 74 3e-14 XP_006492824.1 PREDICTED: dirigent protein 22-like [Citrus sinen... 74 3e-14 XP_016722533.1 PREDICTED: dirigent protein 22-like [Gossypium hi... 74 4e-14 XP_012488321.1 PREDICTED: dirigent protein 22-like [Gossypium ra... 74 4e-14 EOY09568.1 Disease resistance-responsive family protein [Theobro... 74 5e-14 CAN69110.1 hypothetical protein VITISV_006598 [Vitis vinifera] 73 7e-14 XP_009388279.1 PREDICTED: dirigent protein 22-like [Musa acumina... 74 8e-14 XP_012090832.1 PREDICTED: dirigent protein 22-like [Jatropha cur... 73 1e-13 ABD52120.1 dirigent-like protein pDIR9 [Picea engelmannii x Pice... 73 1e-13 ACN40835.1 unknown [Picea sitchensis] 73 1e-13 XP_007162358.1 hypothetical protein PHAVU_001G145200g [Phaseolus... 73 1e-13 XP_002280711.1 PREDICTED: dirigent protein 22 [Vitis vinifera] 73 1e-13 >AFG63904.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63905.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63907.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63910.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63911.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] Length = 50 Score = 73.2 bits (178), Expect = 4e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFH 223 PIVGGSG+FRLARGYA ARTH FD KTGNAVV+YNVTV H Sbjct: 5 PIVGGSGLFRLARGYALARTHSFDLKTGNAVVEYNVTVLH 44 >AEW08907.1 hypothetical protein CL2213Contig1_03, partial [Pinus radiata] AFG63897.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63898.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63899.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63900.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63901.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63902.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63903.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63906.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63908.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] AFG63909.1 hypothetical protein CL2213Contig1_03, partial [Pinus taeda] Length = 50 Score = 73.2 bits (178), Expect = 4e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFH 223 PIVGGSG+FRLARGYA ARTH FD KTGNAVV+YNVTV H Sbjct: 5 PIVGGSGLFRLARGYALARTHSFDLKTGNAVVEYNVTVLH 44 >CDP10173.1 unnamed protein product [Coffea canephora] Length = 154 Score = 75.5 bits (184), Expect = 6e-15 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P+VGGSG+FR ARGYAQARTHYFD KTG+AVV+YNV V HY Sbjct: 114 PVVGGSGLFRFARGYAQARTHYFDLKTGDAVVEYNVYVIHY 154 >XP_017253395.1 PREDICTED: dirigent protein 22-like [Daucus carota subsp. sativus] KZM93792.1 hypothetical protein DCAR_017037 [Daucus carota subsp. sativus] Length = 188 Score = 76.3 bits (186), Expect = 6e-15 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P+VGGSG+FR ARGYAQARTH+FD KTG+AVV+YNV VFHY Sbjct: 148 PVVGGSGLFRFARGYAQARTHFFDLKTGDAVVEYNVYVFHY 188 >XP_006373795.1 hypothetical protein POPTR_0016s06080g, partial [Populus trichocarpa] ERP51592.1 hypothetical protein POPTR_0016s06080g, partial [Populus trichocarpa] Length = 88 Score = 72.8 bits (177), Expect = 1e-14 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FRLARGYAQA+TH D KTGNA V+YNV VFHY Sbjct: 48 PIVGGSGLFRLARGYAQAKTHEIDFKTGNATVEYNVYVFHY 88 >XP_007029061.1 PREDICTED: dirigent protein 22 [Theobroma cacao] EOY09563.1 Disease resistance-responsive (dirigent-like protein) family protein, putative [Theobroma cacao] Length = 194 Score = 75.1 bits (183), Expect = 2e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FRLARGYA+ARTH FD KTGN VV+YNV VFHY Sbjct: 154 PIVGGSGVFRLARGYAEARTHTFDLKTGNTVVEYNVYVFHY 194 >AEX11972.1 hypothetical protein 0_18318_01, partial [Pinus taeda] AEX11973.1 hypothetical protein 0_18318_01, partial [Pinus taeda] Length = 117 Score = 72.8 bits (177), Expect = 3e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PI+GGSG+FRLARGYA ARTH FD KTGNAVV+Y+VTV HY Sbjct: 77 PILGGSGLFRLARGYALARTHSFDLKTGNAVVEYDVTVLHY 117 >KJB46354.1 hypothetical protein B456_007G362500 [Gossypium raimondii] Length = 185 Score = 74.3 bits (181), Expect = 3e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P++GGSG+FR ARGYA+ARTH FD KTGNAVV+YNV VFHY Sbjct: 145 PVIGGSGVFRFARGYAEARTHTFDLKTGNAVVEYNVYVFHY 185 >KDO70858.1 hypothetical protein CISIN_1g043227mg [Citrus sinensis] Length = 190 Score = 74.3 bits (181), Expect = 3e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQA+TH FD KTG+AVV+YNV VFHY Sbjct: 150 PIVGGSGLFRFARGYAQAKTHTFDPKTGDAVVEYNVNVFHY 190 >XP_006492824.1 PREDICTED: dirigent protein 22-like [Citrus sinensis] Length = 190 Score = 74.3 bits (181), Expect = 3e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQA+TH FD KTG+AVV+YNV VFHY Sbjct: 150 PIVGGSGLFRFARGYAQAKTHTFDPKTGDAVVEYNVNVFHY 190 >XP_016722533.1 PREDICTED: dirigent protein 22-like [Gossypium hirsutum] Length = 195 Score = 74.3 bits (181), Expect = 4e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P++GGSG+FR ARGYA+ARTH FD KTGNAVV+YNV VFHY Sbjct: 155 PVIGGSGVFRFARGYAEARTHAFDLKTGNAVVEYNVYVFHY 195 >XP_012488321.1 PREDICTED: dirigent protein 22-like [Gossypium raimondii] KJB46355.1 hypothetical protein B456_007G362600 [Gossypium raimondii] Length = 195 Score = 74.3 bits (181), Expect = 4e-14 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P++GGSG+FR ARGYA+ARTH FD KTGNAVV+YNV VFHY Sbjct: 155 PVIGGSGVFRFARGYAEARTHAFDLKTGNAVVEYNVYVFHY 195 >EOY09568.1 Disease resistance-responsive family protein [Theobroma cacao] Length = 196 Score = 73.9 bits (180), Expect = 5e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQA+TH FD KTG+AVV+YNV VFHY Sbjct: 156 PIVGGSGLFRFARGYAQAKTHTFDTKTGDAVVEYNVYVFHY 196 >CAN69110.1 hypothetical protein VITISV_006598 [Vitis vinifera] Length = 154 Score = 72.8 bits (177), Expect = 7e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQARTH F+ KTG+AVV+YNV VFHY Sbjct: 114 PIVGGSGLFRFARGYAQARTHTFNLKTGDAVVEYNVYVFHY 154 >XP_009388279.1 PREDICTED: dirigent protein 22-like [Musa acuminata subsp. malaccensis] Length = 196 Score = 73.6 bits (179), Expect = 8e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 P+VGGSG+FRLARGYAQARTH FD KTG+AVV+YNV V HY Sbjct: 156 PVVGGSGLFRLARGYAQARTHSFDPKTGDAVVEYNVFVMHY 196 >XP_012090832.1 PREDICTED: dirigent protein 22-like [Jatropha curcas] KDP21891.1 hypothetical protein JCGZ_03029 [Jatropha curcas] Length = 194 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQA+TH FD KTG+A+V+YNV VFHY Sbjct: 154 PIVGGSGLFRFARGYAQAKTHTFDLKTGDAIVEYNVYVFHY 194 >ABD52120.1 dirigent-like protein pDIR9 [Picea engelmannii x Picea glauca] Length = 192 Score = 72.8 bits (177), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FRL RGYA ARTH FD K+GNAVV+YNVTV HY Sbjct: 146 PIVGGSGLFRLGRGYALARTHSFDLKSGNAVVEYNVTVLHY 186 >ACN40835.1 unknown [Picea sitchensis] Length = 192 Score = 72.8 bits (177), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FRL RGYA ARTH FD K+GNAVV+YNVTV HY Sbjct: 146 PIVGGSGLFRLGRGYALARTHSFDLKSGNAVVEYNVTVLHY 186 >XP_007162358.1 hypothetical protein PHAVU_001G145200g [Phaseolus vulgaris] ESW34352.1 hypothetical protein PHAVU_001G145200g [Phaseolus vulgaris] Length = 192 Score = 72.8 bits (177), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG FR ARGYAQA+TH FD KTG+AVV+YNV VFHY Sbjct: 152 PIVGGSGAFRFARGYAQAKTHTFDTKTGDAVVEYNVFVFHY 192 >XP_002280711.1 PREDICTED: dirigent protein 22 [Vitis vinifera] Length = 192 Score = 72.8 bits (177), Expect = 1e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 342 PIVGGSGMFRLARGYAQARTHYFDAKTGNAVVKYNVTVFHY 220 PIVGGSG+FR ARGYAQARTH F+ KTG+AVV+YNV VFHY Sbjct: 152 PIVGGSGLFRFARGYAQARTHTFNLKTGDAVVEYNVYVFHY 192