BLASTX nr result
ID: Ephedra29_contig00004578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00004578 (1038 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AET45928.1 ribosomal protein S7 (chloroplast) [Pinus rigida] 159 2e-44 NP_042503.1 ribosomal protein S7 (chloroplast) [Pinus thunbergii... 158 3e-44 AET46072.1 ribosomal protein S7 (chloroplast) [Pinus radiata] AE... 158 3e-44 YP_008082384.1 ribosomal protein S7 (chloroplast) [Pinus taeda] ... 158 3e-44 YP_002586961.1 ribosomal protein S7 (chloroplast) [Syntrichia ru... 157 5e-44 ADT65049.1 ribosomal protein S7 (chloroplast) [Syntrichia norveg... 157 7e-44 AET49805.1 ribosomal protein S7 (chloroplast) [Pinus clausa] 157 1e-43 YP_003934172.1 ribosomal protein S7 [Cedrus deodara] BAJ19555.1 ... 157 1e-43 YP_004891236.1 ribosomal protein S7 (chloroplast) [Larix decidua... 157 1e-43 YP_009268392.1 ribosomal protein S7 (chloroplast) [Tsuga chinens... 155 3e-43 AET48081.1 ribosomal protein S7 (chloroplast) [Pinus jeffreyi] 155 3e-43 AET46354.1 ribosomal protein S7 (chloroplast) [Pinus pseudostrobus] 155 3e-43 AEK78222.1 ribosomal protein S7 (plastid) [Frankenia pulverulenta] 155 3e-43 YP_002519524.1 ribosomal protein S7 [Keteleeria davidiana] YP_00... 155 3e-43 AFJ72950.1 ribosomal protein S7 (chloroplast) [Hookeria lucens] 155 4e-43 Q71L16.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 155 6e-43 NP_817291.1 ribosomal protein S7 [Pinus koraiensis] YP_009117961... 155 6e-43 AET45354.1 ribosomal protein S7 (chloroplast) [Pinus virginiana] 155 6e-43 YP_004891690.1 ribosomal protein S7 (chloroplast) [Picea morriso... 155 6e-43 YP_009248224.1 ribosomal protein S7 (plastid) [Lodoicea maldivic... 154 8e-43 >AET45928.1 ribosomal protein S7 (chloroplast) [Pinus rigida] Length = 155 Score = 159 bits (401), Expect = 2e-44 Identities = 76/135 (56%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTKGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAXANRAFAHFR 155 >NP_042503.1 ribosomal protein S7 (chloroplast) [Pinus thunbergii] YP_008082313.1 ribosomal protein S7 (chloroplast) [Pinus massoniana] YP_009154193.1 ribosomal protein S7 (chloroplast) [Pinus taiwanensis] YP_009183556.1 ribosomal protein S7 (chloroplast) [Pinus tabuliformis] P41652.1 RecName: Full=30S ribosomal protein S7, chloroplastic BAA04458.1 ribosomal protein S7 (chloroplast) [Pinus thunbergii] AET44857.1 ribosomal protein S7 (chloroplast) [Pinus brutia] AET44929.1 ribosomal protein S7 (chloroplast) [Pinus arizonica] AET45071.1 ribosomal protein S7 (chloroplast) [Pinus yunnanensis] AET45141.1 ribosomal protein S7 (chloroplast) [Pinus yecorensis] AET45426.1 ribosomal protein S7 (chloroplast) [Pinus tropicalis] AET45570.1 ribosomal protein S7 (chloroplast) [Pinus sylvestris] AET45784.1 ribosomal protein S7 (chloroplast) [Pinus sabiniana] AET45856.1 ribosomal protein S7 (chloroplast) [Pinus roxburghii] AET46499.1 ribosomal protein S7 (chloroplast) [Pinus ponderosa var. scopulorum] AET46571.1 ribosomal protein S7 (chloroplast) [Pinus ponderosa var. benthamiana] AET46643.1 ribosomal protein S7 (chloroplast) [Pinus pinea] AET47003.1 ribosomal protein S7 (chloroplast) [Pinus pseudostrobus var. apulcensis] AET47075.1 ribosomal protein S7 (chloroplast) [Pinus nigra] AET47218.1 ribosomal protein S7 (chloroplast) [Pinus mugo] AET47505.1 ribosomal protein S7 (chloroplast) [Pinus massoniana] AET47865.1 ribosomal protein S7 (chloroplast) [Pinus latteri] AET47937.1 ribosomal protein S7 (chloroplast) [Pinus kesiya] AET48153.1 ribosomal protein S7 (chloroplast) [Pinus hwangshanensis] AET48225.1 ribosomal protein S7 (chloroplast) [Pinus heldreichii] AET48296.1 ribosomal protein S7 (chloroplast) [Pinus hartwegii] AET48367.1 ribosomal protein S7 (chloroplast) [Pinus halepensis] AET48511.1 ribosomal protein S7 (chloroplast) [Pinus glabra] AET48583.1 ribosomal protein S7 (chloroplast) [Pinus fragilissima] AET49018.1 ribosomal protein S7 (chloroplast) [Pinus hartwegii] AET49162.1 ribosomal protein S7 (chloroplast) [Pinus devoniana] AET49234.1 ribosomal protein S7 (chloroplast) [Pinus densata] AET49306.1 ribosomal protein S7 (chloroplast) [Pinus densiflora] AET49661.1 ribosomal protein S7 (chloroplast) [Pinus coulteri] AET49733.1 ribosomal protein S7 (chloroplast) [Pinus arizonica var. cooperi] AGL11159.1 ribosomal protein S7 (chloroplast) [Pinus massoniana] AKE32330.1 ribosomal protein S7 (chloroplast) [Pinus taiwanensis] ALM88132.1 ribosomal protein S7 (chloroplast) [Pinus tabuliformis] APD52026.1 ribosomal protein S7 (chloroplast) [Pinus mugo subsp. x rotundata] Length = 155 Score = 158 bits (400), Expect = 3e-44 Identities = 76/135 (56%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >AET46072.1 ribosomal protein S7 (chloroplast) [Pinus radiata] AET47147.1 ribosomal protein S7 (chloroplast) [Pinus muricata] Length = 155 Score = 158 bits (400), Expect = 3e-44 Identities = 76/135 (56%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_008082384.1 ribosomal protein S7 (chloroplast) [Pinus taeda] AET44715.1 ribosomal protein S7 (chloroplast) [Pinus caribaea] AET45713.1 ribosomal protein S7 (chloroplast) [Pinus serotina] AET46216.1 ribosomal protein S7 (chloroplast) [Pinus pungens] AET46787.1 ribosomal protein S7 (chloroplast) [Pinus patula] AET46859.1 ribosomal protein S7 (chloroplast) [Pinus palustris] AET46931.1 ribosomal protein S7 (chloroplast) [Pinus occidentalis] AET47577.1 ribosomal protein S7 (chloroplast) [Pinus lumholtzii] AET47649.1 ribosomal protein S7 (chloroplast) [Pinus leiophylla] AET47721.1 ribosomal protein S7 (chloroplast) [Pinus lawsonii] AET47793.1 ribosomal protein S7 (chloroplast) [Pinus pringlei] AET48439.1 ribosomal protein S7 (chloroplast) [Pinus greggii] AET48727.1 ribosomal protein S7 (chloroplast) [Pinus elliottii] AET48871.1 ribosomal protein S7 (chloroplast) [Pinus echinata] AET49589.1 ribosomal protein S7 (chloroplast) [Pinus cubensis] AGL11230.1 ribosomal protein S7 (chloroplast) [Pinus taeda] Length = 155 Score = 158 bits (400), Expect = 3e-44 Identities = 76/135 (56%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTKGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_002586961.1 ribosomal protein S7 (chloroplast) [Syntrichia ruralis] ACL27644.1 ribosomal protein S7 (chloroplast) [Syntrichia ruralis] Length = 155 Score = 157 bits (398), Expect = 5e-44 Identities = 79/135 (58%), Positives = 101/135 (74%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A KIL AM I+ KT K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMMVNRILKHGKKSLAYKILYKAMKNIKQKTKKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EIKS +AIRW++GA+RKR GR M KL ELI+AA+ G+A+RKK E Sbjct: 81 GGSTYQVPIEIKSAQGKALAIRWLLGASRKRSGRNMSFKLSYELIDAARDNGDAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 HK+A NRAF+HFR Sbjct: 141 THKMAEANRAFAHFR 155 >ADT65049.1 ribosomal protein S7 (chloroplast) [Syntrichia norvegica] Length = 155 Score = 157 bits (397), Expect = 7e-44 Identities = 79/135 (58%), Positives = 101/135 (74%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A KIL AM I+ KT K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMMVNRILKHGKKSLAYKILYKAMKNIKQKTKKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EIKS +AIRW++GA+RKR GR M KL ELI+AA+ G+A+RKK E Sbjct: 81 GGSTYQVPIEIKSAQGKALAIRWLLGASRKRSGRNMSFKLSYELIDAARENGDAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 HK+A NRAF+HFR Sbjct: 141 THKMAEANRAFAHFR 155 >AET49805.1 ribosomal protein S7 (chloroplast) [Pinus clausa] Length = 155 Score = 157 bits (396), Expect = 1e-43 Identities = 75/135 (55%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_003934172.1 ribosomal protein S7 [Cedrus deodara] BAJ19555.1 ribosomal protein S7 (chloroplast) [Cedrus deodara] Length = 155 Score = 157 bits (396), Expect = 1e-43 Identities = 76/135 (56%), Positives = 103/135 (76%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR MD KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPVEIRSTQGKVLAIRWLLGASRKRPGRNMDFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_004891236.1 ribosomal protein S7 (chloroplast) [Larix decidua] ACP52246.1 ribosomal protein S7 (chloroplast) [Larix occidentalis] BAK86542.1 ribosomal protein S7 (chloroplast) [Larix decidua] Length = 155 Score = 157 bits (396), Expect = 1e-43 Identities = 76/135 (56%), Positives = 103/135 (76%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR MD KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPIEIRSTQGKVLAIRWLLGASRKRPGRNMDFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_009268392.1 ribosomal protein S7 (chloroplast) [Tsuga chinensis] BAV19298.1 ribosomal protein S7 (chloroplast) [Tsuga chinensis] Length = 155 Score = 155 bits (393), Expect = 3e-43 Identities = 75/135 (55%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL ++ I+ KT+K+PL+VL+QAI +VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRSIKNIQKKTEKNPLSVLRQAIRKVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR MD KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPIEIRSTQGKVLAIRWLLGASRKRPGRNMDFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >AET48081.1 ribosomal protein S7 (chloroplast) [Pinus jeffreyi] Length = 155 Score = 155 bits (393), Expect = 3e-43 Identities = 75/135 (55%), Positives = 102/135 (75%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H+ NRAF+HFR Sbjct: 141 THRXEKANRAFAHFR 155 >AET46354.1 ribosomal protein S7 (chloroplast) [Pinus pseudostrobus] Length = 155 Score = 155 bits (393), Expect = 3e-43 Identities = 75/135 (55%), Positives = 103/135 (76%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KTDK+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTDKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKXX 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >AEK78222.1 ribosomal protein S7 (plastid) [Frankenia pulverulenta] Length = 155 Score = 155 bits (393), Expect = 3e-43 Identities = 76/135 (56%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +I+ A+ +I+ KT+K+PL+VL+QAI VTP + +K+RRV Sbjct: 21 RLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTEKNPLSVLRQAIRGVTPDIAVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+T++VP EI S +AIRW++GAARKR GR M KL EL++AAKG+GEA+RKK E Sbjct: 81 GGSTHQVPIEIGSTQGKALAIRWLLGAARKRPGRNMSFKLSSELLDAAKGSGEAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 HK+A NRAF+HFR Sbjct: 141 THKMAEANRAFAHFR 155 >YP_002519524.1 ribosomal protein S7 [Keteleeria davidiana] YP_004891467.1 ribosomal protein S7 (chloroplast) [Pseudotsuga sinensis var. wilsoniana] YP_009132515.1 ribosomal protein S7 (chloroplast) [Abies koreana] YP_009268450.1 ribosomal protein S7 (chloroplast) [Pseudolarix amabilis] AAV84620.1 ribosomal protein S7 (chloroplast) [Abies lasiocarpa] AAV84622.1 ribosomal protein S7 (chloroplast) [Pseudotsuga menziesii] BAH11389.1 ribosomal protein S7 (chloroplast) [Keteleeria davidiana] BAK86640.1 ribosomal protein S7 (chloroplast) [Pseudotsuga sinensis var. wilsoniana] AET46426.1 ribosomal protein S7 (chloroplast) [Pseudotsuga menziesii var. menziesii] AKA55334.1 ribosomal protein S7 (chloroplast) [Abies koreana] AKJ25281.1 ribosomal protein S7 (plastid) [Abies koreana] AMA21240.1 ribosomal protein S7 (chloroplast) [Abies nephrolepis] BAV19356.1 ribosomal protein S7 (chloroplast) [Pseudolarix amabilis] Length = 155 Score = 155 bits (393), Expect = 3e-43 Identities = 75/135 (55%), Positives = 103/135 (76%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL ++ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRSIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR MD KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPIEIRSTQGKVLAIRWLLGASRKRPGRNMDFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >AFJ72950.1 ribosomal protein S7 (chloroplast) [Hookeria lucens] Length = 155 Score = 155 bits (392), Expect = 4e-43 Identities = 78/135 (57%), Positives = 101/135 (74%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VNQI+K GKK +A +IL AM I+ KT K+PL+VL+QAI VTP V +K+RR+ Sbjct: 21 RLVNMMVNQIIKDGKKSLAYQILYKAMKNIKQKTKKNPLSVLRQAIRRVTPNVTVKARRL 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EIKS +AIRW++GA+RKR GR M KL ELI+AAK G+A+RKK E Sbjct: 81 GGSTYQVPIEIKSAQGKALAIRWLLGASRKRSGRNMAFKLSYELIDAAKDNGDAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >Q71L16.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ05289.1 ribosomal protein S7 (chloroplast) [Cedrus deodara] Length = 155 Score = 155 bits (391), Expect = 6e-43 Identities = 75/135 (55%), Positives = 102/135 (75%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR MD KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPVEIRSTQGKVLAIRWLLGASRKRPGRNMDFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A N AF+HFR Sbjct: 141 THRMAXANXAFAHFR 155 >NP_817291.1 ribosomal protein S7 [Pinus koraiensis] YP_009117961.1 ribosomal protein S7 (plastid) [Pinus strobus] YP_009179930.1 ribosomal protein S7 (chloroplast) [Pinus bungeana] YP_009243519.1 ribosomal protein S7 (chloroplast) [Pinus armandii] YP_009249803.1 ribosomal protein S7 (chloroplast) [Pinus sibirica] Q85WV2.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAO74117.1 ribosomal protein S7 (chloroplast) [Pinus koraiensis] AET44571.1 ribosomal protein S7 (chloroplast) [Pinus chiapensis] AET44643.1 ribosomal protein S7 (chloroplast) [Pinus cembroides] AET44786.1 ribosomal protein S7 (chloroplast) [Pinus bungeana] AET45000.1 ribosomal protein S7 (chloroplast) [Pinus amamiana] AET45212.1 ribosomal protein S7 (chloroplast) [Pinus kwangtungensis] AET45283.1 ribosomal protein S7 (chloroplast) [Pinus wallichiana] AET45641.1 ribosomal protein S7 (chloroplast) [Pinus strobiformis] AET46000.1 ribosomal protein S7 (chloroplast) [Pinus remota] AET46144.1 ribosomal protein S7 (chloroplast) [Pinus quadrifolia] AET46287.1 ribosomal protein S7 (chloroplast) [Pinus pumila] AET47289.1 ribosomal protein S7 (chloroplast) [Pinus morrisonicola] AET47433.1 ribosomal protein S7 (chloroplast) [Pinus maximartinezii] AET48009.1 ribosomal protein S7 (chloroplast) [Pinus johannis] AET48799.1 ribosomal protein S7 (chloroplast) [Pinus edulis] AET49090.1 ribosomal protein S7 (chloroplast) [Pinus discolor] AET49377.1 ribosomal protein S7 (chloroplast) [Pinus dalatensis] AET49445.1 ribosomal protein S7 (chloroplast) [Pinus fenzeliana var. dabeshanensis] AET49517.1 ribosomal protein S7 (chloroplast) [Pinus culminicola] AJE71590.1 ribosomal protein S7 (plastid) [Pinus strobus] AJT70467.1 ribosomal protein S7 (chloroplast) [Pinus armandii] ALL52958.1 ribosomal protein S7 (chloroplast) [Pinus bungeana] ALO20540.1 ribosomal protein S7 (chloroplast) [Pinus sibirica] ANK79096.1 ribosomal protein S7 (chloroplast) [Pinus fenzeliana var. dabeshanensis] Length = 155 Score = 155 bits (391), Expect = 6e-43 Identities = 75/135 (55%), Positives = 102/135 (75%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWLLGASRKRLGRNMKFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >AET45354.1 ribosomal protein S7 (chloroplast) [Pinus virginiana] Length = 155 Score = 155 bits (391), Expect = 6e-43 Identities = 75/135 (55%), Positives = 102/135 (75%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ +I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKKIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPTEIRSTQGKVLAIRWXXGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_004891690.1 ribosomal protein S7 (chloroplast) [Picea morrisonicola] YP_008082868.1 ribosomal protein S7 (chloroplast) (chloroplast) [Picea abies] YP_009185760.1 ribosomal protein S7 (chloroplast) [Picea glauca] YP_009232294.1 ribosomal protein S7 (chloroplast) [Picea jezoensis] YP_009331849.1 ribosomal protein S7 (chloroplast) [Picea crassifolia] YP_009331922.1 ribosomal protein S7 (chloroplast) [Picea asperata] BAK86428.1 ribosomal protein S7 (chloroplast) [Picea morrisonicola] CCW23153.1 ribosomal protein S7 (chloroplast) [Picea abies] ALO64277.1 ribosomal protein S7 (chloroplast) [Picea glauca] AMA21166.1 ribosomal protein S7 (chloroplast) [Picea jezoensis] AOG75946.1 ribosomal protein S7 (chloroplast) [Picea sitchensis] APH07433.1 ribosomal protein S7 (chloroplast) [Picea crassifolia] APH07506.1 ribosomal protein S7 (chloroplast) [Picea asperata] Length = 155 Score = 155 bits (391), Expect = 6e-43 Identities = 75/135 (55%), Positives = 103/135 (76%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+I+K GKK +A +IL A+ I+ KT+K+PL+VL+QAI VTP V +K+RRV Sbjct: 21 RLVNMVVNRILKNGKKSLAYRILYRAIKNIQQKTEKNPLSVLRQAIRRVTPNVTVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+TY+VP EI+S +AIRW++GA+RKR GR M+ KL EL++AA+G G A+RKK E Sbjct: 81 GGSTYRVPIEIRSTQGKVLAIRWLLGASRKRPGRNMNFKLSHELMDAARGNGNAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRMAEANRAFAHFR 155 >YP_009248224.1 ribosomal protein S7 (plastid) [Lodoicea maldivica] YP_009248237.1 ribosomal protein S7 (plastid) [Lodoicea maldivica] AMW66190.1 ribosomal protein S7 (plastid) [Lodoicea maldivica] AMW66204.1 ribosomal protein S7 (plastid) [Lodoicea maldivica] Length = 155 Score = 154 bits (390), Expect = 8e-43 Identities = 74/135 (54%), Positives = 104/135 (77%) Frame = +3 Query: 375 RAANLTVNQIMKCGKKGVAMKILNSAMVRIRDKTDKDPLAVLQQAIHEVTPCVRIKSRRV 554 R N+ VN+IMK GKK +A +I+ A+ +I+ KT+ +PL+VL+QAIH VTP + +K+RRV Sbjct: 21 RLVNMLVNRIMKHGKKSLAYQIIYRAVKKIQQKTETNPLSVLRQAIHGVTPDIAVKARRV 80 Query: 555 GGTTYKVPNEIKSKSAYNVAIRWIVGAARKRKGRTMDAKLCDELIEAAKGTGEAVRKKNE 734 GG+T++VP EI S +AIRW++GA+RKR GR M KL EL++AAKG+G+A+RKK E Sbjct: 81 GGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEE 140 Query: 735 VHKIAVTNRAFSHFR 779 H++A NRAF+HFR Sbjct: 141 THRVAEANRAFAHFR 155