BLASTX nr result
ID: Ephedra29_contig00004031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00004031 (717 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015169701.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 6e-06 >XP_015169701.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Solanum tuberosum] XP_015169702.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Solanum tuberosum] XP_015169703.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Solanum tuberosum] XP_015169704.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Solanum tuberosum] XP_015169705.1 PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Solanum tuberosum] Length = 715 Score = 57.4 bits (137), Expect = 6e-06 Identities = 31/100 (31%), Positives = 51/100 (51%) Frame = -2 Query: 314 IIAHELEDSIRRNKLEDALDAYQRYINEVGIPDKYLMTKYLNFLSQLNELEKASQVVDYV 135 ++ +LE ++R + LE+A + Y+ + G PD +L+ K L LS ++ + + V Sbjct: 83 VLLGKLESALRNHNLEEAWETYKDFKRLYGFPDPFLVDKLLTKLSYSSDSRWLKKACNMV 142 Query: 134 AHVASNPMAHLERETSESLCLKFAIADMPVPASALLRTMV 15 + L E LCL A A MPV AS++LR M+ Sbjct: 143 GSILKEKREMLRTELMTKLCLSLARAQMPVQASSILRLML 182