BLASTX nr result
ID: Ephedra29_contig00003535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00003535 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009783768.1 PREDICTED: protein trichome birefringence-like 42... 53 5e-06 XP_018859086.1 PREDICTED: protein trichome berefringence-like 7 ... 53 5e-06 XP_004969334.1 PREDICTED: protein trichome birefringence-like 38... 52 9e-06 >XP_009783768.1 PREDICTED: protein trichome birefringence-like 42 [Nicotiana sylvestris] XP_016511213.1 PREDICTED: protein trichome birefringence-like 42 [Nicotiana tabacum] Length = 359 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 198 LGNCNLYVGSWTHDDSFPLYDALQCPFI 281 L NCNL+ GSW DDS+PLYD+LQCPFI Sbjct: 37 LTNCNLFEGSWIFDDSYPLYDSLQCPFI 64 >XP_018859086.1 PREDICTED: protein trichome berefringence-like 7 [Juglans regia] Length = 274 Score = 52.8 bits (125), Expect = 5e-06 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +3 Query: 102 IIVSITTLGCGYRVPY-SFFNASEAAVTTPTSG-LGNCNLYVGSWTHDDSFPLYDALQCP 275 +I I +GCGY SF A T+ +G +CN++ GSW DDS+PLY+A +CP Sbjct: 53 LISFIIAIGCGYLFLLPSFSQAFHDYDTSKFNGTFSSCNVFYGSWAQDDSYPLYNATECP 112 Query: 276 FI 281 F+ Sbjct: 113 FV 114 >XP_004969334.1 PREDICTED: protein trichome birefringence-like 38 [Setaria italica] KQL06125.1 hypothetical protein SETIT_001780mg [Setaria italica] Length = 392 Score = 52.4 bits (124), Expect = 9e-06 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 12/88 (13%) Frame = +3 Query: 54 PAMAISSARTLL-CCLLIIVSITTLGCGYRVPYSFFNASE-----------AAVTTPTSG 197 P +A + A +LL C S TLG + P N++ +P +G Sbjct: 11 PLLAAAVACSLLRACGAAAASTGTLGLRHHKPAKKHNSTRHGGGRPRGGGGGGAGSPGTG 70 Query: 198 LGNCNLYVGSWTHDDSFPLYDALQCPFI 281 + CNL+ GSW +DDS P+YD CPF+ Sbjct: 71 MAACNLFQGSWVYDDSLPMYDTAGCPFV 98