BLASTX nr result
ID: Ephedra29_contig00002559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00002559 (729 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERM97260.1 hypothetical protein AMTR_s00119p00113390 [Amborella ... 57 9e-06 XP_006829844.2 PREDICTED: uncharacterized ATP-dependent helicase... 57 1e-05 XP_015885553.1 PREDICTED: helicase sen1 [Ziziphus jujuba] 57 1e-05 >ERM97260.1 hypothetical protein AMTR_s00119p00113390 [Amborella trichopoda] Length = 894 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +1 Query: 583 GWYDVTVIPSNECKLQFKEGDMAVLSTLKQGTARLKKVAPGNGSDE 720 GWYDV V+P +ECK FKEGD+AVLS+ K T RL++ +G++E Sbjct: 68 GWYDVIVLPLHECKWTFKEGDVAVLSSSKPETVRLRRTKVNSGTNE 113 >XP_006829844.2 PREDICTED: uncharacterized ATP-dependent helicase C29A10.10c [Amborella trichopoda] Length = 1116 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +1 Query: 583 GWYDVTVIPSNECKLQFKEGDMAVLSTLKQGTARLKKVAPGNGSDE 720 GWYDV V+P +ECK FKEGD+AVLS+ K T RL++ +G++E Sbjct: 290 GWYDVIVLPLHECKWTFKEGDVAVLSSSKPETVRLRRTKVNSGTNE 335 >XP_015885553.1 PREDICTED: helicase sen1 [Ziziphus jujuba] Length = 1380 Score = 57.0 bits (136), Expect = 1e-05 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +1 Query: 583 GWYDVTVIPSNECKLQFKEGDMAVLSTLKQGTARLKKVAPGNGSDE 720 GWYDV V+P+NECK FKEGD+A+LS+ + G+AR K+ D+ Sbjct: 520 GWYDVVVLPANECKWTFKEGDVAILSSPRPGSARSKRSTSSLAEDD 565