BLASTX nr result
ID: Ephedra29_contig00002125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00002125 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR17479.1 unknown [Picea sitchensis] 61 3e-08 XP_006852556.1 PREDICTED: reticulon-4-interacting protein 1, mit... 56 1e-06 XP_015899148.1 PREDICTED: reticulon-4-interacting protein 1, mit... 54 7e-06 CDP05967.1 unnamed protein product [Coffea canephora] 54 1e-05 >ABR17479.1 unknown [Picea sitchensis] Length = 366 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 105 RSMSTCRAVVLPKFGGPDVLEVRHNVKIPELGQSE 1 R +STCRAVVLP+FGGP+VLEVRHNV +P+LG SE Sbjct: 26 RLISTCRAVVLPRFGGPEVLEVRHNVGLPDLGASE 60 >XP_006852556.1 PREDICTED: reticulon-4-interacting protein 1, mitochondrial [Amborella trichopoda] ERN14023.1 hypothetical protein AMTR_s00021p00197950 [Amborella trichopoda] Length = 362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 STCRAVVLPKFGGPDVLEVRHNVKIPELGQSE 1 +TCRAVVLP+FGGP+VLEVRHNV++PEL E Sbjct: 25 TTCRAVVLPRFGGPEVLEVRHNVEVPELKPRE 56 >XP_015899148.1 PREDICTED: reticulon-4-interacting protein 1, mitochondrial [Ziziphus jujuba] Length = 371 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 135 SRKYGERCWKRSMSTCRAVVLPKFGGPDVLEVRHNVKIPELGQSE 1 S K G RC+ ++TCRAVVLP FGGP+VLE+R NV IP+L +E Sbjct: 24 SMKVGLRCF---VTTCRAVVLPHFGGPEVLELRPNVNIPDLKPNE 65 >CDP05967.1 unnamed protein product [Coffea canephora] Length = 377 Score = 53.5 bits (127), Expect = 1e-05 Identities = 23/46 (50%), Positives = 36/46 (78%) Frame = -2 Query: 138 KSRKYGERCWKRSMSTCRAVVLPKFGGPDVLEVRHNVKIPELGQSE 1 +SR+ + C + +++CRAV+LP+FGGPDVLE+R NV +P+L +E Sbjct: 24 RSRQGFKTCNRSIVTSCRAVLLPRFGGPDVLELRDNVNVPDLKPNE 69