BLASTX nr result
ID: Ephedra29_contig00002117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00002117 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAV53889.1 mechanosensitive channels of small conductance-like [... 77 1e-13 XP_019187338.1 PREDICTED: mechanosensitive ion channel protein 6... 73 4e-12 OAY28835.1 hypothetical protein MANES_15G097900 [Manihot esculenta] 72 1e-11 EYU17549.1 hypothetical protein MIMGU_mgv1a022063mg, partial [Er... 70 3e-11 XP_012829633.1 PREDICTED: mechanosensitive ion channel protein 8... 70 3e-11 XP_016568303.1 PREDICTED: mechanosensitive ion channel protein 8... 70 3e-11 XP_016470246.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_009589280.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_006477826.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_015073842.1 PREDICTED: mechanosensitive ion channel protein 8... 70 3e-11 XP_004238626.1 PREDICTED: mechanosensitive ion channel protein 8... 70 3e-11 XP_019244899.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_016497059.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_009767353.1 PREDICTED: mechanosensitive ion channel protein 6... 70 3e-11 XP_004287609.1 PREDICTED: mechanosensitive ion channel protein 1... 70 5e-11 XP_002964435.1 hypothetical protein SELMODRAFT_81632 [Selaginell... 70 5e-11 XP_002975359.1 hypothetical protein SELMODRAFT_103269 [Selaginel... 70 5e-11 OAY54574.1 hypothetical protein MANES_03G085500 [Manihot esculenta] 69 7e-11 OAY66864.1 Mechanosensitive ion channel protein 10 [Ananas comosus] 69 7e-11 OAY72179.1 Mechanosensitive ion channel protein 10 [Ananas comosus] 69 1e-10 >BAV53889.1 mechanosensitive channels of small conductance-like [Chamaecyparis obtusa] Length = 748 Score = 77.0 bits (188), Expect = 1e-13 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RK+VLYFVYGL+ SV+NC+W+ L I W +FDPRV+R+ HKAL Y+TR Sbjct: 222 RKKVLYFVYGLRKSVQNCLWLGLVILTWILMFDPRVERSTKNHKALSYITR 272 >XP_019187338.1 PREDICTED: mechanosensitive ion channel protein 6-like [Ipomoea nil] XP_019187339.1 PREDICTED: mechanosensitive ion channel protein 6-like [Ipomoea nil] Length = 887 Score = 72.8 bits (177), Expect = 4e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD RV+R N K L YVTR Sbjct: 331 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKRVERATN-GKVLPYVTR 380 >OAY28835.1 hypothetical protein MANES_15G097900 [Manihot esculenta] Length = 889 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGLI 459 RKRVLYFVYG+K +V+NC+W+ L + AW CLFD RV+R K K L YVT+ L+ Sbjct: 336 RKRVLYFVYGIKKAVQNCLWLGLVLIAWHCLFDKRVER-KTKSKTLRYVTKILV 388 >EYU17549.1 hypothetical protein MIMGU_mgv1a022063mg, partial [Erythranthe guttata] Length = 742 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NC+W++L + AW C+FD +V+R +HK L YVT+ Sbjct: 190 RKRVLYFVYGLRNSVQNCVWLALVLIAWQCIFDKKVER-ITSHKILPYVTK 239 >XP_012829633.1 PREDICTED: mechanosensitive ion channel protein 8-like [Erythranthe guttata] Length = 846 Score = 70.5 bits (171), Expect = 3e-11 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NC+W++L + AW C+FD +V+R +HK L YVT+ Sbjct: 294 RKRVLYFVYGLRNSVQNCVWLALVLIAWQCIFDKKVER-ITSHKILPYVTK 343 >XP_016568303.1 PREDICTED: mechanosensitive ion channel protein 8-like [Capsicum annuum] Length = 865 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 315 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 364 >XP_016470246.1 PREDICTED: mechanosensitive ion channel protein 6-like [Nicotiana tabacum] Length = 875 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 326 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 375 >XP_009589280.1 PREDICTED: mechanosensitive ion channel protein 6-like [Nicotiana tomentosiformis] Length = 875 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 326 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 375 >XP_006477826.1 PREDICTED: mechanosensitive ion channel protein 6 [Citrus sinensis] Length = 875 Score = 70.5 bits (171), Expect = 3e-11 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGLI 459 RKRVLYFVYG++ +V+NC+W+ L + AW CLFD RV+R N+ K L+Y T+ LI Sbjct: 330 RKRVLYFVYGVRKAVQNCLWLGLVLIAWHCLFDQRVERETNS-KVLKYATKILI 382 >XP_015073842.1 PREDICTED: mechanosensitive ion channel protein 8-like [Solanum pennellii] Length = 876 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 327 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 376 >XP_004238626.1 PREDICTED: mechanosensitive ion channel protein 8-like [Solanum lycopersicum] Length = 876 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 327 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 376 >XP_019244899.1 PREDICTED: mechanosensitive ion channel protein 6-like [Nicotiana attenuata] OIT03959.1 mechanosensitive ion channel protein 8 [Nicotiana attenuata] Length = 879 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 330 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 379 >XP_016497059.1 PREDICTED: mechanosensitive ion channel protein 6-like [Nicotiana tabacum] Length = 879 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 330 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 379 >XP_009767353.1 PREDICTED: mechanosensitive ion channel protein 6-like [Nicotiana sylvestris] Length = 879 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTR 450 RKRVLYFVYGL++SV+NCIW+SL + AW C+FD +V+ NT K L YV+R Sbjct: 330 RKRVLYFVYGLRNSVQNCIWLSLVLIAWQCIFDKKVESITNT-KVLRYVSR 379 >XP_004287609.1 PREDICTED: mechanosensitive ion channel protein 10-like [Fragaria vesca subsp. vesca] Length = 762 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGL 456 +K+VLYFVYGLK SV+ IW+ L + AW LFD VKR+KNT K L YVTRGL Sbjct: 248 KKKVLYFVYGLKRSVQVFIWLGLILLAWGLLFDHGVKRSKNTSKILGYVTRGL 300 >XP_002964435.1 hypothetical protein SELMODRAFT_81632 [Selaginella moellendorffii] EFJ34768.1 hypothetical protein SELMODRAFT_81632 [Selaginella moellendorffii] Length = 786 Score = 69.7 bits (169), Expect = 5e-11 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGLI 459 RKRVLYFVYGL+ V+ +W++LA+ AW LFDP+V+R+ ++AL YVT+ LI Sbjct: 261 RKRVLYFVYGLRKGVQTALWLTLALVAWLLLFDPKVERSTKNNRALLYVTKVLI 314 >XP_002975359.1 hypothetical protein SELMODRAFT_103269 [Selaginella moellendorffii] EFJ23560.1 hypothetical protein SELMODRAFT_103269 [Selaginella moellendorffii] Length = 786 Score = 69.7 bits (169), Expect = 5e-11 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGLI 459 RKRVLYFVYGL+ V+ +W++LA+ AW LFDP+V+R+ ++AL YVT+ LI Sbjct: 261 RKRVLYFVYGLRKGVQTALWLTLALVAWLLLFDPKVERSTKNNRALLYVTKVLI 314 >OAY54574.1 hypothetical protein MANES_03G085500 [Manihot esculenta] Length = 884 Score = 69.3 bits (168), Expect = 7e-11 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGLI 459 RKRVLYFVYG+K +V+NC+W+ L + AW CLFD +V+R K + L YVT+ L+ Sbjct: 334 RKRVLYFVYGIKKAVQNCLWLGLVLIAWHCLFDKKVER-KTRSRILRYVTKVLV 386 >OAY66864.1 Mechanosensitive ion channel protein 10 [Ananas comosus] Length = 366 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGL 456 +K+VLYFVYGLKDSV+ CIW+ L + +WF LF+ ++R+K T K L YV+R L Sbjct: 229 KKKVLYFVYGLKDSVRACIWLGLVLLSWFLLFNGGLERSKKTTKILNYVSRFL 281 >OAY72179.1 Mechanosensitive ion channel protein 10 [Ananas comosus] Length = 741 Score = 68.9 bits (167), Expect = 1e-10 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +1 Query: 298 RKRVLYFVYGLKDSVKNCIWMSLAIAAWFCLFDPRVKRNKNTHKALEYVTRGL 456 +K+VLYFVYGLKDSV+ CIW+ L + +WF LF+ ++R+K T K L YV+R L Sbjct: 229 KKKVLYFVYGLKDSVRACIWLGLVLLSWFLLFNGGLERSKKTTKILNYVSRFL 281