BLASTX nr result
ID: Ephedra29_contig00002107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00002107 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR17479.1 unknown [Picea sitchensis] 59 2e-08 XP_006852556.1 PREDICTED: reticulon-4-interacting protein 1, mit... 54 1e-06 XP_015899148.1 PREDICTED: reticulon-4-interacting protein 1, mit... 52 5e-06 >ABR17479.1 unknown [Picea sitchensis] Length = 366 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 RSMSTCRAVVLPKFGGPGVLEVRHNVKIPELGQSE 1 R +STCRAVVLP+FGGP VLEVRHNV +P+LG SE Sbjct: 26 RLISTCRAVVLPRFGGPEVLEVRHNVGLPDLGASE 60 >XP_006852556.1 PREDICTED: reticulon-4-interacting protein 1, mitochondrial [Amborella trichopoda] ERN14023.1 hypothetical protein AMTR_s00021p00197950 [Amborella trichopoda] Length = 362 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 96 STCRAVVLPKFGGPGVLEVRHNVKIPELGQSE 1 +TCRAVVLP+FGGP VLEVRHNV++PEL E Sbjct: 25 TTCRAVVLPRFGGPEVLEVRHNVEVPELKPRE 56 >XP_015899148.1 PREDICTED: reticulon-4-interacting protein 1, mitochondrial [Ziziphus jujuba] Length = 371 Score = 52.4 bits (124), Expect = 5e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -2 Query: 135 SRKYGERCWKRSMSTCRAVVLPKFGGPGVLEVRHNVKIPELGQSE 1 S K G RC+ ++TCRAVVLP FGGP VLE+R NV IP+L +E Sbjct: 24 SMKVGLRCF---VTTCRAVVLPHFGGPEVLELRPNVNIPDLKPNE 65