BLASTX nr result
ID: Ephedra29_contig00002043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00002043 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_042151784.1 cytochrome P450 [Planktothrix agardhii] KEI65700.... 77 6e-15 WP_026797674.1 cytochrome P450 [Planktothrix prolifica] CUR27234... 77 6e-15 WP_026786834.1 cytochrome P450 [Planktothrix rubescens] 77 8e-15 CUM60699.1 putative cytochrome P450 120 [Planktothrix agardhii] 75 2e-14 WP_027254743.1 cytochrome P450 [Planktothrix agardhii] 75 2e-14 WP_027249318.1 cytochrome P450 [Planktothrix agardhii] 75 2e-14 WP_015148608.1 cytochrome P450 [Oscillatoria acuminata] AFY81966... 75 2e-14 CUR11084.1 putative cytochrome P450 120 [Planktothrix paucivesic... 74 6e-14 OIP70751.1 cytochrome P450 [Oscillatoriales cyanobacterium CG2_3... 74 6e-14 XP_003617455.1 cytochrome P450 family protein [Medicago truncatu... 74 8e-14 WP_046663729.1 cytochrome P450 [Microcystis aeruginosa] 73 1e-13 WP_002803393.1 cytochrome P450 [Microcystis aeruginosa] CCI37737... 73 1e-13 AKE64757.1 cytochrome P450 [Microcystis aeruginosa NIES-2549] AO... 73 1e-13 WP_002760161.1 cytochrome P450 [Microcystis aeruginosa] CCH97559... 73 2e-13 XP_007217282.1 hypothetical protein PRUPE_ppa017753mg [Prunus pe... 72 3e-13 CUR22032.1 putative cytochrome P450 120 [Planktothrix sp. PCC 11... 72 3e-13 KGN47995.1 hypothetical protein Csa_6G423370 [Cucumis sativus] 72 3e-13 WP_023067074.1 cytochrome P450 [Lyngbya aestuarii] ERT06680.1 pu... 72 3e-13 WP_009783180.1 cytochrome P450 [Lyngbya sp. PCC 8106] EAW38299.1... 72 3e-13 ONI17644.1 hypothetical protein PRUPE_3G171100 [Prunus persica] 72 3e-13 >WP_042151784.1 cytochrome P450 [Planktothrix agardhii] KEI65700.1 Cyp [Planktothrix agardhii NIVA-CYA 126/8] Length = 444 Score = 77.0 bits (188), Expect = 6e-15 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPLSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >WP_026797674.1 cytochrome P450 [Planktothrix prolifica] CUR27234.1 putative cytochrome P450 120 [Planktothrix rubescens] Length = 444 Score = 77.0 bits (188), Expect = 6e-15 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPLSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >WP_026786834.1 cytochrome P450 [Planktothrix rubescens] Length = 444 Score = 76.6 bits (187), Expect = 8e-15 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPLSTRILLGKGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >CUM60699.1 putative cytochrome P450 120 [Planktothrix agardhii] Length = 444 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPPSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >WP_027254743.1 cytochrome P450 [Planktothrix agardhii] Length = 444 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPPSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >WP_027249318.1 cytochrome P450 [Planktothrix agardhii] Length = 444 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGAEANRFLFANENKYFIVAWPPSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >WP_015148608.1 cytochrome P450 [Oscillatoria acuminata] AFY81966.1 cytochrome P450 [Oscillatoria acuminata PCC 6304] Length = 444 Score = 75.5 bits (184), Expect = 2e-14 Identities = 32/68 (47%), Positives = 45/68 (66%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ +RR KYG ++KTHL G P VV+ G+EAN+F+ T+DN F WP+ST L+G +L Sbjct: 33 DFQKKRREKYGTVYKTHLFGQPTVVLVGSEANRFLFTHDNSYFSATWPYSTRTLLGPQSL 92 Query: 183 ASSHFEHH 206 A+ H Sbjct: 93 ATQSGNEH 100 >CUR11084.1 putative cytochrome P450 120 [Planktothrix paucivesiculata PCC 9631] Length = 444 Score = 74.3 bits (181), Expect = 6e-14 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M G+EAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGSEANRFLFANENKYFIVAWPPSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >OIP70751.1 cytochrome P450 [Oscillatoriales cyanobacterium CG2_30_40_61] Length = 444 Score = 74.3 bits (181), Expect = 6e-14 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R+ +YG IFKTHL G P V+M G+EAN+F+ N+NK FI WP ST L+G+ +L Sbjct: 33 DFADKRQKQYGSIFKTHLFGRPTVIMMGSEANRFLFANENKYFIVAWPPSTRILLGQGSL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SMQLGDIHK 101 >XP_003617455.1 cytochrome P450 family protein [Medicago truncatula] AET00414.1 cytochrome P450 family protein [Medicago truncatula] Length = 479 Score = 73.9 bits (180), Expect = 8e-14 Identities = 32/69 (46%), Positives = 49/69 (71%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ + R +K+G IFKT ++G P V++ GAEANKFIL+N+ KL + WP S+ HL+G+D++ Sbjct: 66 DFVHPRITKHGKIFKTRIIGSPTVIVNGAEANKFILSNEFKLVKSSWPSSSVHLMGKDSI 125 Query: 183 ASSHFEHHK 209 E H+ Sbjct: 126 MEKDGERHR 134 >WP_046663729.1 cytochrome P450 [Microcystis aeruginosa] Length = 434 Score = 73.2 bits (178), Expect = 1e-13 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ N+R +KYG +F+TH+ G P +++ GAEAN+F+L+N+NK F WP ST L+G +L Sbjct: 30 DFANKRHNKYGQLFRTHIFGSPTIILSGAEANRFLLSNENKYFAATWPKSTKTLLGSASL 89 Query: 183 A 185 A Sbjct: 90 A 90 >WP_002803393.1 cytochrome P450 [Microcystis aeruginosa] CCI37737.1 putative cytochrome P450 120 [Microcystis aeruginosa PCC 9701] Length = 434 Score = 73.2 bits (178), Expect = 1e-13 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ N+R +KYG +F+TH+ G P +++ GAEAN+F+L+N+NK F WP ST L+G +L Sbjct: 30 DFANKRHNKYGQLFRTHIFGSPTIILSGAEANRFLLSNENKYFAATWPKSTKTLLGSASL 89 Query: 183 A 185 A Sbjct: 90 A 90 >AKE64757.1 cytochrome P450 [Microcystis aeruginosa NIES-2549] AOC53157.1 cytochrome P450 [Microcystis aeruginosa NIES-2481] Length = 443 Score = 73.2 bits (178), Expect = 1e-13 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ N+R +KYG +F+TH+ G P +++ GAEAN+F+L+N+NK F WP ST L+G +L Sbjct: 39 DFANKRHNKYGQLFRTHIFGSPTIILSGAEANRFLLSNENKYFAATWPKSTKTLLGSASL 98 Query: 183 A 185 A Sbjct: 99 A 99 >WP_002760161.1 cytochrome P450 [Microcystis aeruginosa] CCH97559.1 putative cytochrome P450 120 [Microcystis aeruginosa PCC 9717] Length = 434 Score = 72.8 bits (177), Expect = 2e-13 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ ++R KYG +F+TH+ G P +++ GAEAN+F+L+N+NK F WP STT L+G +L Sbjct: 30 DFASKRHHKYGQLFRTHIFGSPTIILSGAEANRFLLSNENKYFAATWPKSTTTLLGSASL 89 Query: 183 A 185 A Sbjct: 90 A 90 >XP_007217282.1 hypothetical protein PRUPE_ppa017753mg [Prunus persica] Length = 438 Score = 72.4 bits (176), Expect = 3e-13 Identities = 30/69 (43%), Positives = 47/69 (68%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ R +KYG IF THL+G P V++ GA ANKF+L+N+ KL ++ WP ++ L+G+D++ Sbjct: 24 DFIQPRVTKYGKIFSTHLMGSPTVIVNGANANKFLLSNEFKLVVSSWPSASVQLMGKDSI 83 Query: 183 ASSHFEHHK 209 E H+ Sbjct: 84 MEKQGERHR 92 >CUR22032.1 putative cytochrome P450 120 [Planktothrix sp. PCC 11201] Length = 442 Score = 72.4 bits (176), Expect = 3e-13 Identities = 33/66 (50%), Positives = 46/66 (69%) Frame = +3 Query: 12 NERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDALASS 191 ++R+ +YG IFKTHL G P V+M GAEAN+F+ N+NK FI WP ST L+G+ +L+ Sbjct: 36 DKRQKQYGAIFKTHLFGRPTVIMMGAEANRFLFANENKYFIATWPPSTRILLGQGSLSMQ 95 Query: 192 HFEHHK 209 + HK Sbjct: 96 LGDIHK 101 >KGN47995.1 hypothetical protein Csa_6G423370 [Cucumis sativus] Length = 444 Score = 72.4 bits (176), Expect = 3e-13 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ R +KYG IFKT+L+G P VV+ GAEAN+F L+N+ KL ++ WP S+ L+GE+ + Sbjct: 24 DFVEPRVAKYGKIFKTNLMGSPTVVVNGAEANRFFLSNEFKLVVSSWPSSSVQLMGEECI 83 Query: 183 ASSHFEHHK 209 E H+ Sbjct: 84 MQKEGEKHR 92 >WP_023067074.1 cytochrome P450 [Lyngbya aestuarii] ERT06680.1 putative cytochrome P450 [Lyngbya aestuarii BL J] Length = 444 Score = 72.4 bits (176), Expect = 3e-13 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ +R KYG +FKT++ G P ++M G+EAN+FI TN+ K F + WP ST L+G DAL Sbjct: 33 DFAKKRHQKYGSVFKTNIFGRPTIMMIGSEANRFIFTNEKKYFESKWPASTRTLLGPDAL 92 Query: 183 ASSHFEHHK 209 + + HK Sbjct: 93 SIQTGDIHK 101 >WP_009783180.1 cytochrome P450 [Lyngbya sp. PCC 8106] EAW38299.1 cytochrome P450 [Lyngbya sp. PCC 8106] Length = 444 Score = 72.4 bits (176), Expect = 3e-13 Identities = 32/69 (46%), Positives = 45/69 (65%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ +R KYG +FKT++ G+P ++M G EAN+FI TN+ K F N WP STT L+G +L Sbjct: 33 DFATKRHQKYGSVFKTNIFGNPTIMMIGTEANQFIFTNEKKYFENSWPPSTTALLGPASL 92 Query: 183 ASSHFEHHK 209 + HK Sbjct: 93 TIQTGDIHK 101 >ONI17644.1 hypothetical protein PRUPE_3G171100 [Prunus persica] Length = 463 Score = 72.4 bits (176), Expect = 3e-13 Identities = 30/69 (43%), Positives = 47/69 (68%) Frame = +3 Query: 3 DWYNERRSKYGDIFKTHLVGDPVVVMFGAEANKFILTNDNKLFINGWPFSTTHLIGEDAL 182 D+ R +KYG IF THL+G P V++ GA ANKF+L+N+ KL ++ WP ++ L+G+D++ Sbjct: 49 DFIQPRVTKYGKIFSTHLMGSPTVIVNGANANKFLLSNEFKLVVSSWPSASVQLMGKDSI 108 Query: 183 ASSHFEHHK 209 E H+ Sbjct: 109 MEKQGERHR 117