BLASTX nr result
ID: Ephedra29_contig00001891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00001891 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011097879.1 PREDICTED: protein translation factor SUI1 homolo... 92 2e-21 XP_012443536.1 PREDICTED: protein translation factor SUI1 homolo... 91 3e-21 XP_016731104.1 PREDICTED: protein translation factor SUI1 homolo... 91 3e-21 XP_010533344.1 PREDICTED: protein translation factor SUI1 homolo... 90 4e-21 XP_002960838.1 hypothetical protein SELMODRAFT_437304 [Selaginel... 91 4e-21 XP_012459968.1 PREDICTED: protein translation factor SUI1 homolo... 91 5e-21 XP_010545205.1 PREDICTED: protein translation factor SUI1 homolo... 90 8e-21 XP_010542418.1 PREDICTED: protein translation factor SUI1 homolo... 90 8e-21 XP_010539284.1 PREDICTED: protein translation factor SUI1 homolo... 90 8e-21 XP_008244365.1 PREDICTED: protein translation factor SUI1 homolo... 90 8e-21 XP_011095399.1 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 XP_007021029.2 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 XP_015069422.1 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 XP_009378877.1 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 XP_004294347.1 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 XP_007213988.1 hypothetical protein PRUPE_ppa013607mg [Prunus pe... 90 1e-20 XP_004234488.1 PREDICTED: protein translation factor SUI1 homolo... 90 1e-20 CAC84489.1 putative translation factor [Pinus pinaster] ABK20970... 90 1e-20 OMO80548.1 Translation initiation factor SUI1 [Corchorus capsula... 89 2e-20 XP_019451041.1 PREDICTED: protein translation factor SUI1 homolo... 89 2e-20 >XP_011097879.1 PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum] Length = 112 Score = 91.7 bits (226), Expect = 2e-21 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+D ELGKVIQLQGDQRKNVSQFLISAG+VKKD IKIHGF Sbjct: 66 FCCNGTVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF 112 >XP_012443536.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Gossypium raimondii] KJB62620.1 hypothetical protein B456_009G426500 [Gossypium raimondii] KJB62622.1 hypothetical protein B456_009G426500 [Gossypium raimondii] Length = 113 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELGKVIQLQGDQRKNVS FL+ AG+VKKD+IKIHGF Sbjct: 67 FCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF 113 >XP_016731104.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Gossypium hirsutum] XP_016680166.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Gossypium hirsutum] XP_017603514.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Gossypium arboreum] KHG12156.1 hypothetical protein F383_20129 [Gossypium arboreum] Length = 113 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELGKVIQLQGDQRKNVS FL+ AG+VKKD+IKIHGF Sbjct: 67 FCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF 113 >XP_010533344.1 PREDICTED: protein translation factor SUI1 homolog 2-like, partial [Tarenaya hassleriana] Length = 87 Score = 90.1 bits (222), Expect = 4e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AGLVKKD IKIHGF Sbjct: 41 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 87 >XP_002960838.1 hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii] XP_002983834.1 hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii] EFJ14846.1 hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii] EFJ38377.1 hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii] Length = 114 Score = 90.9 bits (224), Expect = 4e-21 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVSQFL+ AG+VKKD IKIHGF Sbjct: 68 FCCNGTVVQDPELGQVIQLQGDQRKNVSQFLVQAGVVKKDLIKIHGF 114 >XP_012459968.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Gossypium raimondii] KJB13596.1 hypothetical protein B456_002G083300 [Gossypium raimondii] Length = 113 Score = 90.5 bits (223), Expect = 5e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVVEDPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF 113 >XP_010545205.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya hassleriana] XP_010545206.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya hassleriana] Length = 113 Score = 90.1 bits (222), Expect = 8e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AGLVKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >XP_010542418.1 PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya hassleriana] Length = 113 Score = 90.1 bits (222), Expect = 8e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AGLVKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >XP_010539284.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya hassleriana] XP_010539285.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya hassleriana] Length = 113 Score = 90.1 bits (222), Expect = 8e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AGLVKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >XP_008244365.1 PREDICTED: protein translation factor SUI1 homolog 2 [Prunus mume] Length = 113 Score = 90.1 bits (222), Expect = 8e-21 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FLI AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSSFLIQAGIVKKDNIKIHGF 113 >XP_011095399.1 PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum] XP_011095400.1 PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum] Length = 112 Score = 89.7 bits (221), Expect = 1e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNG VV+D ELGKVIQLQGDQRKNVSQFLISAG+VKKD IKIHGF Sbjct: 66 FCCNGNVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF 112 >XP_007021029.2 PREDICTED: protein translation factor SUI1 homolog 2 [Theobroma cacao] XP_017979979.1 PREDICTED: protein translation factor SUI1 homolog 2 [Theobroma cacao] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD+IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF 113 >XP_015069422.1 PREDICTED: protein translation factor SUI1 homolog 2 [Solanum pennellii] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FLI AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKDNIKIHGF 113 >XP_009378877.1 PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus x bretschneideri] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF 113 >XP_004294347.1 PREDICTED: protein translation factor SUI1 homolog [Fragaria vesca subsp. vesca] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF 113 >XP_007213988.1 hypothetical protein PRUPE_ppa013607mg [Prunus persica] ONI13137.1 hypothetical protein PRUPE_4G205000 [Prunus persica] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF 113 >XP_004234488.1 PREDICTED: protein translation factor SUI1 homolog 1 [Solanum lycopersicum] XP_006343300.1 PREDICTED: protein translation factor SUI1 homolog 1 [Solanum tuberosum] XP_019068251.1 PREDICTED: protein translation factor SUI1 homolog 1 [Solanum lycopersicum] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FLI AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKDNIKIHGF 113 >CAC84489.1 putative translation factor [Pinus pinaster] ABK20970.1 unknown [Picea sitchensis] ABK22220.1 unknown [Picea sitchensis] ABK23355.1 unknown [Picea sitchensis] ABK26752.1 unknown [Picea sitchensis] ABR16497.1 unknown [Picea sitchensis] ABR18467.1 unknown [Picea sitchensis] ACN39759.1 unknown [Picea sitchensis] ACN40001.1 unknown [Picea sitchensis] ACN40379.1 unknown [Picea sitchensis] ACN40927.1 unknown [Picea sitchensis] Length = 113 Score = 89.7 bits (221), Expect = 1e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF 113 >OMO80548.1 Translation initiation factor SUI1 [Corchorus capsularis] OMP04494.1 Translation initiation factor SUI1 [Corchorus olitorius] Length = 113 Score = 89.4 bits (220), Expect = 2e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF 113 >XP_019451041.1 PREDICTED: protein translation factor SUI1 homolog 1 [Lupinus angustifolius] XP_019451042.1 PREDICTED: protein translation factor SUI1 homolog 1 [Lupinus angustifolius] OIW05932.1 hypothetical protein TanjilG_07208 [Lupinus angustifolius] Length = 113 Score = 89.4 bits (220), Expect = 2e-20 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 400 FCCNGTVVEDPELGKVIQLQGDQRKNVSQFLISAGLVKKDTIKIHGF 260 FCCNGTVV+DPELG+VIQLQGDQRKNVS FL+ AG+VKKD IKIHGF Sbjct: 67 FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF 113