BLASTX nr result
ID: Ephedra29_contig00001496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00001496 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004244776.1 PREDICTED: thiocyanate methyltransferase 1 [Solan... 56 2e-06 XP_018674337.1 PREDICTED: probable thiol methyltransferase 2 iso... 55 3e-06 XP_009420136.1 PREDICTED: probable thiol methyltransferase 2 iso... 55 3e-06 XP_015083511.1 PREDICTED: probable thiol methyltransferase 2 [So... 54 8e-06 >XP_004244776.1 PREDICTED: thiocyanate methyltransferase 1 [Solanum lycopersicum] Length = 247 Score = 55.8 bits (133), Expect = 2e-06 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = +3 Query: 264 TKRETRVRQLVNTQPLENWDKCWEEGVTPWDLGHRTP 374 +K + +++QL+++ P WDKCWE+GVTPWDLG TP Sbjct: 33 SKPKDKIQQLLHSDPYGGWDKCWEKGVTPWDLGQPTP 69 >XP_018674337.1 PREDICTED: probable thiol methyltransferase 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 271 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +3 Query: 255 PALTKRETRVRQLVNTQPLENWDKCWEEGVTPWDLGHRTP 374 PA + +R LVN + W+KCWEEG+TPWDLG TP Sbjct: 64 PASNPKVVMIRGLVNDDATDGWEKCWEEGLTPWDLGQATP 103 >XP_009420136.1 PREDICTED: probable thiol methyltransferase 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 281 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +3 Query: 255 PALTKRETRVRQLVNTQPLENWDKCWEEGVTPWDLGHRTP 374 PA + +R LVN + W+KCWEEG+TPWDLG TP Sbjct: 64 PASNPKVVMIRGLVNDDATDGWEKCWEEGLTPWDLGQATP 103 >XP_015083511.1 PREDICTED: probable thiol methyltransferase 2 [Solanum pennellii] Length = 248 Score = 53.9 bits (128), Expect = 8e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 279 RVRQLVNTQPLENWDKCWEEGVTPWDLGHRTP 374 +++QL+++ P WDKCWE+GVTPWDLG TP Sbjct: 39 KIQQLLHSDPSGGWDKCWEKGVTPWDLGQPTP 70