BLASTX nr result
ID: Ephedra29_contig00000957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00000957 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005644670.1 hypothetical protein COCSUDRAFT_67495 [Coccomyxa ... 61 6e-08 XP_011399502.1 Phosphoglucan, water dikinase, chloroplastic [Aux... 60 1e-07 JAT76920.1 hypothetical protein g.21674, partial [Auxenochlorell... 60 2e-07 XP_001696825.1 hypothetical protein CHLREDRAFT_150073 [Chlamydom... 56 3e-06 XP_002956065.1 hypothetical protein VOLCADRAFT_97031 [Volvox car... 56 4e-06 >XP_005644670.1 hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea C-169] EIE20126.1 hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea C-169] Length = 470 Score = 61.2 bits (147), Expect = 6e-08 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = -1 Query: 498 GPSMTWTDGDVWISTITLEGGASYEYKAVVVDNGTGECICWMPGNNRVLTLPSSSNT 328 GP + WT+GD W +T+ L GG YEYK V++D+ +G + W GNN VL + + + Sbjct: 228 GPDLRWTEGDNWRATVELPGGTVYEYKYVLLDSYSGHALSWQRGNNSVLAIKAGEES 284 >XP_011399502.1 Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella protothecoides] KFM26564.1 Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella protothecoides] Length = 287 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 498 GPSMTWTDGDVWISTITLEGGASYEYKAVVVDNGTGECICWMPGNNRVLTL 346 G +M WT GD W++ + L G YEYK VVVD+ +G + W GNN VL L Sbjct: 59 GHNMKWTTGDNWVAEVDLPTGTVYEYKFVVVDHASGHALAWQSGNNSVLAL 109 >JAT76920.1 hypothetical protein g.21674, partial [Auxenochlorella protothecoides] Length = 308 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 498 GPSMTWTDGDVWISTITLEGGASYEYKAVVVDNGTGECICWMPGNNRVLTL 346 G +M WT GD W++ + L G YEYK VVVD+ +G + W GNN VL L Sbjct: 21 GHNMKWTTGDNWVAEVDLPTGTVYEYKFVVVDHASGHALAWQSGNNSVLAL 71 >XP_001696825.1 hypothetical protein CHLREDRAFT_150073 [Chlamydomonas reinhardtii] EDP00933.1 predicted protein [Chlamydomonas reinhardtii] Length = 323 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = -1 Query: 489 MTWTDGDVWISTITLEGGASYEYKAVVVDNGTGECICWMPGNNRVLTLPSSSNTYVE 319 ++WTDGD W++TI L G+ YEYK V+VD+ + W G+N VL + VE Sbjct: 60 LSWTDGDRWVATIELPAGSVYEYKYVLVDHDGRSALAWQGGSNSVLAIGDQDEQGVE 116 >XP_002956065.1 hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis] EFJ42805.1 hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis] Length = 385 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/58 (43%), Positives = 33/58 (56%) Frame = -1 Query: 492 SMTWTDGDVWISTITLEGGASYEYKAVVVDNGTGECICWMPGNNRVLTLPSSSNTYVE 319 ++ WTDGD WI+ + L GA YEYK V+VD+ + + W G N VL L VE Sbjct: 63 NLDWTDGDRWIAAVELPAGAVYEYKYVLVDHDSRATLAWQGGGNSVLALGDQDGQGVE 120