BLASTX nr result
ID: Ephedra28_contig00030296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00030296 (599 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25048.1| unknown [Picea sitchensis] 67 5e-09 gb|AFG67414.1| hypothetical protein CL4360Contig1_02, partial [P... 57 3e-06 gb|AEW09155.1| hypothetical protein CL4360Contig1_02, partial [P... 57 3e-06 gb|AFG67415.1| hypothetical protein CL4360Contig1_02, partial [P... 56 8e-06 >gb|ABK25048.1| unknown [Picea sitchensis] Length = 510 Score = 66.6 bits (161), Expect = 5e-09 Identities = 46/137 (33%), Positives = 66/137 (48%), Gaps = 3/137 (2%) Frame = +2 Query: 41 MSPGGCMEEAAMGLTAQLVGMLDEDEMXXXXXXXXXXXXXXXXXXXSEF---QPQSEEEA 211 M G +EAA+GL AQ+ + E + E P+ +E Sbjct: 376 MEKRGAHQEAAIGLAAQIFKFMTELKFNRVFKEWRAVTKRLLISELVEVFRRHPRPSKEV 435 Query: 212 PCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTFSGSVGVT 391 +RRFS+EL V+EK + R L + L+ ++ TTSEME Y TFSGSVG++ Sbjct: 436 ASIRRFSIELLIAVMEK----DDKAALEERTDLVNALEGVMETTSEMESYSTFSGSVGLS 491 Query: 392 PHSLSMHDLVLSAIHTL 442 H + +H LV SA+ L Sbjct: 492 RHRIPIHSLVQSAMELL 508 >gb|AFG67414.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/77 (38%), Positives = 46/77 (59%) Frame = +2 Query: 191 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 370 P+ E P +RRFS+EL V++ + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLFAVMKMDRSAIEMM----RSELEEALEAVMETTSEMESYSTF 66 Query: 371 SGSVGVTPHSLSMHDLV 421 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83 >gb|AEW09155.1| hypothetical protein CL4360Contig1_02, partial [Pinus radiata] gi|383168640|gb|AFG67416.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168642|gb|AFG67417.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168644|gb|AFG67418.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168646|gb|AFG67419.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168648|gb|AFG67420.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168650|gb|AFG67421.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168652|gb|AFG67422.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168654|gb|AFG67423.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168656|gb|AFG67424.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168658|gb|AFG67425.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168660|gb|AFG67426.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/77 (38%), Positives = 46/77 (59%) Frame = +2 Query: 191 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 370 P+ E P +RRFS+EL V++ + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLIAVMKMDRSAIEMM----RSELEEALEAVMETTSEMESYSTF 66 Query: 371 SGSVGVTPHSLSMHDLV 421 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83 >gb|AFG67415.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 55.8 bits (133), Expect = 8e-06 Identities = 30/77 (38%), Positives = 45/77 (58%) Frame = +2 Query: 191 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 370 P+ E P +RRFS+EL V + + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLIAVTKIDRSAIEMM----RSELEETLEAVMETTSEMESYSTF 66 Query: 371 SGSVGVTPHSLSMHDLV 421 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83