BLASTX nr result
ID: Ephedra28_contig00029981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00029981 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [A... 56 4e-06 >ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] gi|548848037|gb|ERN07140.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] Length = 212 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 374 LMALIVNDVPGVNQDRCVKMALVHDIAEEISANFT 270 +MALI ND+PGVN+DRC+KMA+VHDIAE I + T Sbjct: 69 VMALIANDIPGVNRDRCIKMAIVHDIAEAIVGDIT 103