BLASTX nr result
ID: Ephedra28_contig00029880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00029880 (685 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73984.1| hypothetical protein M569_00764 [Genlisea aurea] 58 3e-06 ref|XP_002869395.1| hypothetical protein ARALYDRAFT_491740 [Arab... 58 3e-06 >gb|EPS73984.1| hypothetical protein M569_00764 [Genlisea aurea] Length = 881 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 540 MGCSSSKLDDEPIVVRCKERKLLIKQIINYRYGFAMAHERYVQSL 674 MGCS SK+DD P+V+RC+ER+ LI+ ++RY FA AH Y +SL Sbjct: 1 MGCSGSKVDDLPLVIRCRERRDLIRAAAHHRYAFAAAHVSYFRSL 45 >ref|XP_002869395.1| hypothetical protein ARALYDRAFT_491740 [Arabidopsis lyrata subsp. lyrata] gi|297315231|gb|EFH45654.1| hypothetical protein ARALYDRAFT_491740 [Arabidopsis lyrata subsp. lyrata] Length = 725 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/48 (56%), Positives = 32/48 (66%) Frame = +3 Query: 540 MGCSSSKLDDEPIVVRCKERKLLIKQIINYRYGFAMAHERYVQSLGQV 683 MGCS SK DD+ V CK+RK IKQ + YR GFA H Y+QSL +V Sbjct: 1 MGCSHSKFDDDEAVQICKDRKRFIKQAVEYRTGFASGHIAYIQSLRKV 48